WERAM Information


Tag Content
WERAM ID WERAM-Gaa-0123
Ensembl Protein ID ENSGACP00000015717.1
Gene Name kdm5bb
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSGACG00000011868.1 ENSGACT00000015748.1 ENSGACP00000015717.1
Status Unreviewed
Classification
Type Family E-value Score Start End
HDM JARID 2.50e-99 330.5 445 611
Me_Reader PHD 8.20e-27 93.6 303 1513
Organism Gasterosteus aculeatus
Domain Profile
  HDM JARID

             JARID.txt   1 eyaesgwnlnnlpvleesvlahinadisgvkvpwlyvgmcfsafcwhvedhwsysinylhfgepkvwygvpgsaaekleevlkklapel 89 
+y ++gwnlnnl++++ svl+h++adi+g+++pwlyvgmcfs+fcwh+edhwsysinylh+gepk+wyg pg aae+leev++klapel
ENSGACP00000015717.1 445 KYLKCGWNLNNLAMMNPSVLTHVTADICGMTLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGFAAEQLEEVMRKLAPEL 533
699************************************************************************************** PP
JARID.txt 90 fesqpdllhqlvtllnpnilkeegvpvyrtnqkagefvitfprayhsgfnqgfnfaeavnfatvdwlaagreavesys 167
fesqpdllhqlvt++npn+l+ +gvp+yrtnq+agefvitfprayhsgfnqgfnfaeavnf+tvdw++ gr++v++y+
ENSGACP00000015717.1 534 FESQPDLLHQLVTIMNPNTLMAHGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWMPLGRQCVDHYR 611
*****************************************************************************7 PP

  Me_Reader PHD

               PHD.txt   3 iClvCgkddegekemvqCdeCddwfHlkCvklplsslpegkswyCpsCk 51 
+ClvCg +++e+ ++ Cd+Cdd +H+ C+ +pl +p+g +w+Cp+C
ENSGACP00000015717.1 303 VCLVCGSGGDEER-LLLCDGCDDSYHTFCLIPPLPDIPKG-DWRCPKCL 349
8****77777766.**************************.*******6 PP
PHD.txt 2 tiClvCgkddegekemvqCdeCddwfHlkCvklplsslpegkswyCpsCke 52
++C+ C+k+ g+ m+qC+ C+++fH Cv p s+ + w+Cp C +
ENSGACP00000015717.1 1170 KVCV-CQKAPMGA--MLQCELCRNAFHSVCVREPSDSCGTQ-PWLCPLCHR 1216
68*9.*8888885..*******************7777777.8******75 PP
PHD.txt 3 iClv..CgkddegekemvqCde.CddwfHlkCvklplsslpegkswyCpsCk 51
+C++ C+ ++ +e +vqCd+ C++wfH+ Cv+++ + ++++ +++C +C+
ENSGACP00000015717.1 1463 VCPAerCQLPEGDEVDWVQCDGsCNQWFHQVCVGVTAEMAEKE-DYICVRCT 1513
5776669878888888********************6555566.9******7 PP

Protein Sequence
(Fasta)
MSQPRTDEFK PPPECPVFEP SWEEFRDPFA FINKIRPIAE KTGICKVRPP PGWQPPFACD 60
VDKLHFVPRI QRLNELEAQT RVKLNFLDQI AKFWDLQGCA LKIPHVERKI LDLYKLNKLV 120
ADEGGFDVVC QERLWTKIAL QMGFAPGKAV GSHLRGHYEK VLYPYNLFQS GANLLCVPRP 180
IQPVESTDSM DTKDTKDAML QEPAQRTTAP QPDSGPTARR AKRMKCEAVC VKTEPGESGD 240
NKPNLRRRMG SFVAKQEPEK EIPIPVKQEP VESKEPILEA DKTKSRYKKF IPPVFSSPVD 300
LVVCLVCGSG GDEERLLLCD GCDDSYHTFC LIPPLPDIPK GDWRCPKCLA QECNKPHEAF 360
GFEQAYRDYS LRAFGQMADA FKSDYFNMPV HMVPTELVEK EFWRLVGAIE EDVTVEYGAD 420
IASKDFGSGF PIPNGKFKVS PADEKYLKCG WNLNNLAMMN PSVLTHVTAD ICGMTLPWLY 480
VGMCFSSFCW HIEDHWSYSI NYLHWGEPKT WYGAPGFAAE QLEEVMRKLA PELFESQPDL 540
LHQLVTIMNP NTLMAHGVPI YRTNQCAGEF VITFPRAYHS GFNQGFNFAE AVNFCTVDWM 600
PLGRQCVDHY RMLGRYNVFS HDEMVCNMAA KASTLDVVLA SAVHKDMVVM LQEEETQREN 660
VKKMGMVHTT EAKYDHLQDD ERQCARCRTT CYLSAVTCPC SPGVLVCLHH VNDLCSCPIG 720
DYTLNLRYTL DELFPMMTAV KQRAELYDEW ASLVKETLEA KLEKKKGLPV FRSLLAESES 780
KLFPDNDLLR RLRMVTQDGE KCSSVAQQLL NGKRQTRYRF GSGKSCSQLS VEELSSFVRQ 840
LYNLSCSLPQ APMLKELLNR IEDFQQHSEK VLADEAPGVA EIQSLLDVSF DFDVELPELP 900
RLRVRLEQAR WLEGAQQASA QPSTLTLETM RKLIDQGVGL EAHPSVEKAM ARLQELLTVS 960
EHWEDKASSL LKARPPHSIE TLSAAAEKAS GIPAYLSNCR LLRDTVRKAR EWLQEAEELQ 1020
VGDCTVMMDS LSDMVLRGQA APVHFEPLER LESLMVEVQE WRESAARTFL QRDSTLSLLE 1080
VLCPRCEVGN MGSPKRKAKK GKESPKSNKK KTPRLNNLSD VEKALSETRD STSAMATLEE 1140
LRVREMEAFS NLRTANESKL LPTADCMDLK VCVCQKAPMG AMLQCELCRN AFHSVCVREP 1200
SDSCGTQPWL CPLCHRAEKP PLNKAASLLA SLRRIGVRLP EGDALHYLVE RTVNWQHRAQ 1260
EIKQYFNLPE VEERPGTPPT LTRWASGSHE AHDDTQAPCL TPEWNRTSHN QTVFYTEQRC 1320
IPLQGLSHDL EELMVEGLLL QVCLPEVQSL FHVLLDRASS QHANRCPSPR QDKAADCEEH 1380
MPFNSGKNPP ANQDAVNGGR EATIGSENKA KRHLDGVNAE HRVKEKKHSH KRQKMNKKRP 1440
ASTSSSPRSD FSQSDDSDEE MAVCPAERCQ LPEGDEVDWV QCDGSCNQWF HQVCVGVTAE 1500
MAEKEDYICV RCTLNDGHMR K 1521
Nucleotide Sequence
(Fasta)
CGACCGACTA CAACCGAGAC CGACCGTGAA CAAAACGGGA TTTTAAAAAA GGAAAAAGCA 60
GCCCACCCCA GGCGGACCGC ACCACGGCGA TACTTCCAGT GAGTGACCGG TCCAGCAGGA 120
GCTCCCCCCC CCGGGTCGGT CCGCGACGAT GAGCCAGCCT CGGACGGACG AGTTCAAGCC 180
TCCTCCGGAG TGCCCGGTCT TCGAGCCGAG CTGGGAAGAA TTCAGAGATC CGTTTGCCTT 240
CATCAATAAG ATCCGTCCCA TCGCCGAGAA AACGGGCATC TGCAAAGTCC GCCCGCCTCC 300
GGGTTGGCAA CCTCCGTTTG CTTGTGATGT GGACAAACTT CACTTTGTTC CTCGGATCCA 360
GAGGCTCAAT GAGCTGGAGG CACAGACCAG AGTCAAGCTC AATTTCTTGG ACCAGATTGC 420
CAAATTCTGG GACTTGCAGG GATGTGCCCT GAAGATTCCT CATGTGGAGA GAAAGATTTT 480
GGATTTATAT AAACTCAATA AGCTGGTAGC CGACGAGGGT GGATTTGACG TTGTCTGCCA 540
GGAAAGGCTT TGGACCAAGA TCGCACTACA AATGGGTTTT GCCCCGGGCA AAGCGGTCGG 600
CTCGCACCTG CGAGGGCATT ATGAGAAAGT TCTCTACCCC TACAACCTGT TTCAAAGTGG 660
AGCAAACCTG CTGTGTGTTC CGAGGCCAAT CCAGCCGGTG GAGAGCACAG ATAGCATGGA 720
CACCAAGGAC ACCAAGGACG CCATGCTGCA GGAGCCGGCT CAGAGGACGA CTGCCCCGCA 780
GCCCGACTCG GGCCCCACTG CTCGCAGAGC GAAGCGCATG AAGTGCGAGG CCGTCTGTGT 840
GAAGACCGAA CCCGGCGAGT CCGGAGACAA CAAGCCCAAC CTGAGGCGGA GGATGGGTTC 900
CTTTGTCGCC AAGCAAGAAC CAGAAAAAGA GATCCCGATT CCAGTGAAAC AAGAACCAGT 960
TGAAAGTAAA GAACCAATAC TTGAAGCCGA CAAAACCAAG TCGCGTTACA AGAAATTCAT 1020
CCCTCCTGTT TTTTCAAGTC CAGTGGATCT GGTGGTGTGT CTGGTGTGCG GCAGCGGGGG 1080
AGATGAAGAG CGCCTGTTGC TGTGTGACGG CTGTGACGAC AGCTACCACA CCTTCTGCCT 1140
GATCCCTCCT CTACCTGACA TCCCCAAAGG AGACTGGAGG TGCCCCAAAT GTCTCGCTCA 1200
GGAATGCAAC AAACCTCACG AGGCATTCGG CTTTGAACAG GCATACAGAG ACTACTCCCT 1260
GCGTGCATTT GGACAAATGG CTGATGCGTT CAAATCCGAT TACTTCAACA TGCCAGTTCA 1320
TATGGTACCC ACAGAGCTGG TGGAGAAAGA GTTCTGGCGG TTGGTGGGAG CCATCGAGGA 1380
GGATGTTACT GTAGAGTACG GAGCAGATAT TGCCTCAAAG GACTTTGGCA GCGGGTTCCC 1440
CATTCCCAAC GGAAAATTCA AAGTCTCCCC AGCTGATGAG AAATACCTGA AGTGTGGCTG 1500
GAACCTCAAC AATCTGGCGA TGATGAACCC TTCCGTTCTG ACTCATGTGA CAGCTGACAT 1560
CTGTGGGATG ACGCTGCCAT GGCTTTATGT TGGCATGTGC TTCTCCTCCT TCTGCTGGCA 1620
CATCGAGGAT CACTGGAGCT ACTCCATCAA CTACCTGCAC TGGGGGGAAC CCAAAACGTG 1680
GTACGGAGCT CCTGGCTTTG CTGCAGAACA GCTGGAGGAG GTGATGAGGA AATTGGCTCC 1740
AGAGCTGTTC GAGTCTCAGC CCGACCTATT GCACCAGCTG GTCACCATCA TGAACCCCAA 1800
CACTCTGATG GCCCACGGAG TCCCAATTTA CAGAACAAAC CAGTGTGCAG GAGAGTTTGT 1860
CATCACGTTT CCCAGAGCCT ACCACAGCGG CTTCAATCAG GGCTTCAACT TCGCTGAGGC 1920
GGTCAACTTC TGCACTGTGG ACTGGATGCC TCTTGGCAGG CAGTGTGTGG ACCACTATCG 1980
TATGCTGGGC CGGTACAATG TGTTCTCCCA TGATGAGATG GTGTGCAACA TGGCCGCCAA 2040
GGCGAGCACG CTCGATGTCG TCCTGGCATC AGCTGTCCAC AAAGACATGG TCGTCATGCT 2100
CCAGGAAGAG GAGACGCAAA GAGAGAATGT GAAGAAAATG GGGATGGTGC ACACCACAGA 2160
GGCAAAGTAC GACCACCTCC AGGACGACGA GCGGCAGTGC GCCAGGTGCA GGACCACCTG 2220
CTACCTGTCT GCTGTCACCT GTCCCTGCAG CCCAGGTGTA CTGGTCTGTC TGCACCACGT 2280
CAACGACCTC TGCTCCTGCC CCATCGGCGA TTACACACTC AATCTCAGGT ACACACTGGA 2340
CGAGCTGTTC CCCATGATGA CAGCGGTGAA GCAGCGAGCC GAACTGTATG ATGAATGGGC 2400
TTCCCTCGTG AAGGAGACTC TTGAGGCTAA ACTAGAGAAG AAGAAAGGTC TGCCAGTCTT 2460
TCGCTCGCTT CTTGCCGAGT CGGAGTCCAA GCTGTTCCCC GACAACGACC TGCTGCGTCG 2520
GCTGCGCATG GTCACACAAG ACGGAGAGAA GTGCTCCTCC GTGGCACAGC AGCTGTTGAA 2580
TGGCAAGAGG CAGACCAGGT ATCGGTTTGG AAGTGGGAAG TCATGCAGCC AGCTGAGTGT 2640
GGAGGAGCTG AGTTCCTTTG TGAGGCAGCT GTATAATCTC TCCTGCAGTC TCCCTCAAGC 2700
TCCCATGCTG AAGGAACTCC TGAATCGCAT CGAAGACTTC CAGCAGCACA GCGAGAAGGT 2760
CCTGGCGGAC GAAGCTCCCG GCGTCGCCGA GATCCAGAGC CTGTTGGACG TCAGTTTCGA 2820
CTTTGACGTG GAGTTGCCCG AGCTGCCCCG CCTGCGGGTG AGGCTGGAGC AGGCGCGCTG 2880
GCTGGAGGGG GCGCAGCAGG CCAGCGCCCA GCCTTCCACG CTGACCCTGG AGACCATGAG 2940
GAAGCTCATC GACCAGGGGG TCGGCCTGGA AGCTCACCCG TCCGTGGAGA AAGCCATGGC 3000
ACGCCTGCAG GAGCTGCTCA CTGTGTCCGA GCACTGGGAG GACAAGGCGA GCAGCCTCCT 3060
CAAAGCCAGA CCACCACACT CCATAGAGAC TCTTAGTGCT GCAGCAGAGA AGGCGTCCGG 3120
CATCCCCGCT TACCTTTCAA ACTGTCGCCT CCTAAGAGAC ACTGTCAGAA AAGCCAGAGA 3180
GTGGCTTCAA GAAGCTGAGG AGCTTCAGGT GGGTGATTGC ACAGTGATGA TGGACAGCCT 3240
CTCTGACATG GTGCTACGAG GACAAGCCGC TCCAGTCCAC TTCGAGCCTT TAGAGCGGCT 3300
CGAGTCTTTA ATGGTAGAAG TGCAAGAATG GAGAGAATCT GCAGCTCGAA CTTTCCTTCA 3360
GAGAGACTCA ACCCTTTCCT TACTGGAGGT CCTATGTCCA AGATGTGAAG TTGGCAATAT 3420
GGGTTCTCCA AAGCGCAAAG CCAAGAAAGG AAAAGAATCG CCAAAAAGTA ACAAGAAGAA 3480
AACTCCACGG CTAAACAATC TCAGTGACGT GGAAAAAGCT CTTTCAGAGA CCAGAGACTC 3540
CACCTCTGCA ATGGCGACTC TGGAGGAGCT GCGGGTGAGA GAGATGGAGG CTTTCTCTAA 3600
TCTCAGGACG GCGAATGAGT CCAAGCTCCT TCCTACAGCC GACTGCATGG ACCTGAAGGT 3660
GTGCGTCTGT CAGAAAGCGC CCATGGGTGC GATGTTACAG TGTGAACTCT GCAGAAATGC 3720
TTTCCACAGC GTTTGCGTCC GAGAGCCGTC GGACTCTTGC GGAACGCAGC CGTGGCTCTG 3780
TCCGCTGTGC CATCGGGCAG AAAAGCCCCC CCTGAACAAA GCCGCGTCTC TGCTGGCCTC 3840
CCTGCGGCGC ATCGGGGTGC GCCTGCCGGA GGGCGACGCG CTGCACTATC TGGTCGAGAG 3900
GACTGTTAAC TGGCAGCATC GAGCGCAGGA GATCAAACAG TATTTTAACC TACCAGAAGT 3960
GGAAGAGAGA CCCGGGACTC CTCCCACCTT AACCCGCTGG GCATCGGGCA GCCACGAAGC 4020
TCACGACGAC ACTCAGGCTC CGTGTTTGAC TCCAGAGTGG AACAGGACAA GCCATAACCA 4080
GACCGTCTTC TACACGGAGC AGAGATGCAT CCCGCTGCAG GGCCTGAGCC ATGATCTGGA 4140
GGAGCTGATG GTGGAGGGGC TCTTGCTGCA GGTGTGTCTG CCGGAGGTGC AGAGCCTCTT 4200
CCACGTTTTA TTGGACAGAG CCAGCAGTCA GCACGCAAAC CGATGCCCGT CGCCACGACA 4260
GGACAAAGCC GCAGACTGTG AGGAACACAT GCCGTTTAAC TCCGGAAAGA ATCCGCCAGC 4320
GAACCAGGAT GCCGTCAATG GAGGGAGGGA AGCTACGATT GGCTCCGAAA ATAAAGCGAA 4380
GCGGCATCTG GACGGAGTAA ACGCAGAGCA CCGAGTGAAG GAGAAAAAGC ACTCCCATAA 4440
AAGACAGAAG ATGAATAAAA AGAGGCCGGC CTCGACCTCC TCCTCCCCAC GCTCTGATTT 4500
CTCCCAGTCC GATGACTCCG ATGAGGAGAT GGCCGTGTGT CCCGCAGAGA GGTGTCAGCT 4560
GCCGGAGGGA GATGAGGTGG ACTGGGTCCA GTGTGACGGC AGCTGTAACC AGTGGTTCCA 4620
CCAAGTCTGC GTTGGCGTCA CGGCGGAGAT GGCTGAGAAG GAGGACTACA TTTGTGTCAG 4680
GTGTACTCTG AATGATGGAC ACATGAGAAA ATAAAGAGAA TGTGATGAGG TCGGTCATCA 4740
CTCCATTTTA TTCGAGCCGG AAGTCTGGAT GTGTCACTGA TCCGAAGGCC CCGCCCACAA 4800
GCCCCATCCC ATCTGTCTGC CCCCTTTTTA AACAACGGTG CTATCTCCTC TTTGACTTGT 4860
TGTGCAGAAC TATAATGTTT TAGTTATTTT TTGTATTTTA CATATATATA TATATATCTA 4920
TCTATATAGA TATATATATT TCTTCTTATG GATTGTTTGT GGTTGTCTAA ATGAAAGAAA 4980
AAAAAACTGG GGATGTGAAG TGCGCTGCAT GGGATTCCAT ATCATCAGCG CTAAGGAGTC 5040
TTTAGAACTG TAAAGTGGGT AATAATCATA ATAATCATGG GTTAATAATC TCTCTGGACC 5100
CTCCGTGCAT GTTAACTAAG GGGATCGGAG TCACGGTTTC CATCCCTTAC TCCCCAAAAA 5160
ATGACTACAC ATTTTTTTGA AATCCAGTGT TTAGTACATG CATCTTAATA TAATTATTCC 5220
CATTTTTTTG TAGAATAGGT TAATTTATCT GAGCAATAAT TTTTGTCTGA ATCGACTTAA 5280
ATGGCTCGAT CTCGGCTGAG TTGTGTTGCT GCTTTGGCGA TGGTGTGATG TACAGAGAGC 5340
GACGTGGACA GATTGGATTA CCTCTGTGGT GGTCTGCGGC GACACGTCAC CACCACCACA 5400
GCATGTAGCG TAGGATGCTC CGGGGACAAT GTTACAAGTT TATATTGTGG AATAAAGCCC 5460
TTTTGTTCT
Sequence Source Ensembl
Orthology
WERAM ID Ensembl Protein ID Species Identity E-value Score
WERAM-Orn-0203 ENSONIP00000021125.1 Oreochromis niloticus 84 0.0 2542
WERAM-Xim-0141 ENSXMAP00000011505.1 Xiphophorus maculatus 82 0.0 2477
WERAM-Pof-0075 ENSPFOP00000007131.1 Poecilia formosa 81 0.0 2449
WERAM-Orla-0162 ENSORLP00000018794.1 Oryzias latipes 79 0.0 2397
WERAM-Gam-0220 ENSGMOP00000021028.1 Gadus morhua 73 0.0 2143
WERAM-Leo-0093 ENSLOCP00000012401.1 Lepisosteus oculatus 70 0.0 2092
WERAM-Asm-0204 ENSAMXP00000019198.1 Astyanax mexicanus 67 0.0 2018
WERAM-Dar-0006 ENSDARP00000023794.8 Danio rerio 66 0.0 1974
WERAM-Ora-0026 ENSOANP00000003977.2 Ornithorhynchus anatinus 63 0.0 1887
WERAM-Mod-0006 ENSMODP00000000907.3 Monodelphis domestica 62 0.0 1880
WERAM-Caj-0066 ENSCJAP00000011420.1 Callithrix jacchus 62 0.0 1876
WERAM-Hos-0095 ENSP00000356234.3 Homo sapiens 63 0.0 1874
WERAM-Paa-0101 ENSPANP00000008251.1 Papio anubis 63 0.0 1871
WERAM-Chs-0174 ENSCSAP00000010292.1 Chlorocebus sabaeus 62 0.0 1870
WERAM-Dan-0026 ENSDNOP00000002490.3 Dasypus novemcinctus 62 0.0 1869
WERAM-Ict-0007 ENSSTOP00000000336.2 Ictidomys tridecemlineatus 63 0.0 1865
WERAM-Mup-0127 ENSMPUP00000011091.1 Mustela putorius furo 62 0.0 1857
WERAM-Pat-0014 ENSPTRP00000003106.4 Pan troglodytes 61 0.0 1854
WERAM-Mum-0172 ENSMUSP00000038138.7 Mus musculus 62 0.0 1854
WERAM-Orc-0074 ENSOCUP00000006924.2 Oryctolagus cuniculus 62 0.0 1849
WERAM-Anc-0049 ENSACAP00000005126.2 Anolis carolinensis 61 0.0 1847
WERAM-Mam-0137 ENSMMUP00000019971.2 Macaca mulatta 62 0.0 1843
WERAM-Nol-0196 ENSNLEP00000021988.1 Nomascus leucogenys 60 0.0 1817
WERAM-Fec-0131 ENSFCAP00000012150.3 Felis catus 62 0.0 1791
WERAM-Xet-0055 ENSXETP00000017471.2 Xenopus tropicalis 60 0.0 1788
WERAM-Eqc-0105 ENSECAP00000012327.1 Equus caballus 62 0.0 1785
WERAM-Aim-0135 ENSAMEP00000012770.1 Ailuropoda melanoleuca 61 0.0 1779
WERAM-Myl-0169 ENSMLUP00000013690.2 Myotis lucifugus 60 0.0 1777
WERAM-Caf-0114 ENSCAFP00000015414.3 Canis familiaris 61 0.0 1774
WERAM-Cap-0120 ENSCPOP00000009555.2 Cavia porcellus 61 0.0 1773
WERAM-Gaga-0003 ENSGALP00000000581.4 Gallus gallus 61 0.0 1756
WERAM-Loa-0058 ENSLAFP00000004277.3 Loxodonta africana 61 0.0 1750
WERAM-Ova-0196 ENSOARP00000019777.1 Ovis aries 60 0.0 1750
WERAM-Bot-0065 ENSBTAP00000028871.5 Bos taurus 60 0.0 1748
WERAM-Meg-0012 ENSMGAP00000000890.1 Meleagris gallopavo 60 0.0 1746
WERAM-Fia-0040 ENSFALP00000002732.1 Ficedula albicollis 60 0.0 1738
WERAM-Sus-0075 ENSSSCP00000011653.2 Sus scrofa 66 0.0 1715
WERAM-Tar-0156 ENSTRUP00000033883.1 Takifugu rubripes 57 0.0 1686
WERAM-Ten-0086 ENSTNIP00000009875.1 Tetraodon nigroviridis 58 0.0 1682
WERAM-Tag-0021 ENSTGUP00000001314.1 Taeniopygia guttata 64 0.0 1674
WERAM-Lac-0113 ENSLACP00000013785.1 Latimeria chalumnae 56 0.0 1661
WERAM-Anp-0064 ENSAPLP00000007396.1 Anas platyrhynchos 66 0.0 1627
WERAM-Soa-0117 ENSSARP00000011095.1 Sorex araneus 62 0.0 1612
WERAM-Ptv-0118 ENSPVAP00000010397.1 Pteropus vampyrus 60 0.0 1546
WERAM-Pes-0122 ENSPSIP00000014677.1 Pelodiscus sinensis 59 0.0 1521
WERAM-Poa-0002 ENSPPYP00000000382.2 Pongo abelii 64 0.0 1489
WERAM-Otg-0082 ENSOGAP00000006368.2 Otolemur garnettii 59 0.0 1469
WERAM-Ran-0255 ENSRNOP00000072712.1 Rattus norvegicus 69 0.0 1447
WERAM-Tut-0013 ENSTTRP00000001014.1 Tursiops truncatus 64 0.0 1422
WERAM-Mim-0054 ENSMICP00000005521.1 Microcebus murinus 61 0.0 1392
WERAM-Tas-0106 ENSTSYP00000011121.1 Tarsius syrichta 61 0.0 1386
WERAM-Gog-0032 ENSGGOP00000003025.2 Gorilla gorilla 49 0.0 1334
WERAM-Ere-0012 ENSEEUP00000000667.1 Erinaceus europaeus 57 0.0 1330
WERAM-Chh-0094 ENSCHOP00000010801.1 Choloepus hoffmanni 71 0.0 1264
WERAM-Dio-0026 ENSDORP00000002899.1 Dipodomys ordii 55 0.0 1204
WERAM-Ect-0130 ENSETEP00000014721.1 Echinops telfairi 60 0.0 1155
WERAM-Pem-0068 ENSPMAP00000007536.1 Petromyzon marinus 44 0.0 1154
WERAM-Ocp-0067 ENSOPRP00000005882.1 Ochotona princeps 47 0.0 1119
WERAM-Sah-0178 ENSSHAP00000018525.1 Sarcophilus harrisii 55 0.0 1086
WERAM-Mae-0078 ENSMEUP00000007759.1 Macropus eugenii 44 0.0 1077
WERAM-Prc-0069 ENSPCAP00000006593.1 Procavia capensis 54 0.0 1021
WERAM-Vip-0061 ENSVPAP00000005616.1 Vicugna pacos 60 0.0 986
WERAM-Drm-0042 FBpp0311492 Drosophila melanogaster 39 0.0 986
WERAM-Cis-0007 ENSCSAVP00000000871.1 Ciona savignyi 39 0.0 907
WERAM-Cii-0031 ENSCINP00000012442.3 Ciona intestinalis 42 0.0 868
WERAM-Tub-0047 ENSTBEP00000005645.1 Tupaia belangeri 51 0.0 829
WERAM-Ast-0008 CADATEAP00004027 Aspergillus terreus 31 5e-145 513
WERAM-Cae-0018 ZK593.4a Caenorhabditis elegans 34 3e-143 507
WERAM-Crn-0020 AAW43237 Cryptococcus neoformans 32 1e-130 466
WERAM-Lab-0033 EDR12730 Laccaria bicolor 34 5e-130 463
WERAM-Miv-0011 MVLG_01737T0 Microbotryum violaceum 34 2e-123 442
WERAM-Usm-0016 UM02582P0 Ustilago maydis 28 8e-123 439
WERAM-Coi-0029 EAS31076 Coccidioides immitis 30 5e-118 424
WERAM-Tum-0032 CAZ86330 Tuber melanosporum 36 2e-117 422
WERAM-Asfu-0009 CADAFUAP00002555 Aspergillus fumigatus 33 2e-117 422
WERAM-Spr-0023 CBQ72974 Sporisorium reilianum 29 1e-114 412
WERAM-Asn-0018 CADANIAP00004258 Aspergillus nidulans 37 2e-113 409
WERAM-Asc-0001 CADACLAP00000026 Aspergillus clavatus 36 8e-113 406
WERAM-Amt-0017 ERM95079 Amborella trichopoda 30 1e-112 405
WERAM-Asf-0028 CADAFLAP00010689 Aspergillus flavus 34 1e-110 399
WERAM-Aso-0031 CADAORAP00009644 Aspergillus oryzae 34 1e-110 399
WERAM-Asni-0025 CADANGAP00007970 Aspergillus niger 34 1e-110 399
WERAM-Pytr-0035 EDU44093 Pyrenophora triticirepentis 35 1e-103 376
WERAM-Scs-0004 EDN96551 Sclerotinia sclerotiorum 34 3e-103 375
WERAM-Pyt-0008 EFQ94561 Pyrenophora teres 34 1e-102 373
WERAM-Lem-0001 CBY01560 Leptosphaeria maculans 34 1e-101 369
WERAM-Trv-0029 EHK20007 Trichoderma virens 34 1e-101 369
WERAM-Zyt-0030 Mycgr3P74352 Zymoseptoria tritici 33 2e-101 368
WERAM-Trr-0012 EGR49606 Trichoderma reesei 34 3e-101 368
WERAM-Phn-0021 SNOT_11200 Phaeosphaeria nodorum 35 7e-101 367
WERAM-Thc-0041 EOY24718 Theobroma cacao 42 6e-100 363
WERAM-Nec-0020 EFNCRP00000004299 Neurospora crassa 34 3e-99 361
WERAM-Mao-0014 MGG_04878T0 Magnaporthe oryzae 33 4e-99 361
WERAM-Map-0012 MAPG_04048T0 Magnaporthe poae 33 1e-98 359
WERAM-Met-0120 AES94050 Medicago truncatula 43 4e-98 357
WERAM-Gag-0021 GGTG_06066T0 Gaeumannomyces graminis 34 2e-97 355
WERAM-Glm-0121 GLYMA11G02580.4 Glycine max 43 5e-97 354
WERAM-Sol-0104 Solyc08g081000.2.1 Solanum lycopersicum 42 1e-96 352
WERAM-Arl-0119 scaffold_200168.1 Arabidopsis lyrata 41 4e-96 351
WERAM-Bro-0173 Bo9g029100.1 Brassica oleracea 41 4e-96 350
WERAM-Brr-0139 Bra027644.1-P Brassica rapa 41 1e-95 349