WERAM Information


Tag Content
WERAM ID WERAM-Mim-0073
Ensembl Protein ID ENSMICP00000007053.1
Gene Name PRDM6
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMICG00000007754.1 ENSMICT00000007751.1 ENSMICP00000007053.1
Status Unreviewed
Classification
Type Family E-value Score Start End
HMT RIZ 6.80e-33 113 49 167
Organism Microcebus murinus
Domain Profile
  HMT RIZ

               RIZ.txt   2 evelaessipkeglgvyakkkiekgekfGPfvGekkileevee..nanekliweisedkgevkyivDasdeeksnWlryvnvArskeeq 88 
ev l++s++p+ g+ a+++i++g+ +GPf G +e+v+ n++ +wei++++g+ ++++D+ +++ks+W+ry+++Ar + eq
ENSMICP00000007053.1 49 EVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLPPEKVQAgaVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGEQ 137
6789*******************************999999862257899*************************************** PP
RIZ.txt 89 NLaalqineqifYktikdIepdeELLvwyk 118
NL+++q+ ++ifY+++ dI+ ++ELLvwy+
ENSMICP00000007053.1 138 NLTVVQYRSNIFYRACIDIPRGTELLVWYN 167
*****************************6 PP

Protein Sequence
(Fasta)
CDMCADNRNG ECPMHGPLHS LRRLVGTSSA AAAAPPPELP EWLRDLPREV CLCTSTVPGL 60
AYGICAAQRI QQGTWIGPFQ GVLLPPEKVQ AGAVRNTQHL WEIYDQDGTL QHFIDGGEPS 120
KSSWMRYIRC ARHCGEQNLT VVQYRSNIFY RACIDIPRGT ELLVWYNDSY TSFFGIPLQC 180
IAQDENLNVP STVMEAMCRQ DALQPFSKSS KLSPGPPQRS VVFPQTPCSR NFSLLDKSGP 240
IDSGFNQINV KNQRVLASPT STSQLHSEFS DWHLWKCGQC FKTFTQRILL QMHVCTQNPD 300
RPYQCGHCSQ SFSQPSELRN HVVTHSSDRP FKCGYCGRAF AGATTLNNHI RTHTGEKPFK 360
CERCERSFTQ ATQLSRHQRM PNECKPITES PESIEVD 397
Nucleotide Sequence
(Fasta)
TGCGACATGT GCGCAGACAA CCGCAACGGC GAGTGCCCCA TGCACGGGCC CCTGCACTCG 60
CTGCGCCGGC TCGTGGGCAC CAGCAGCGCC GCAGCGGCCG CGCCCCCGCC GGAGCTGCCG 120
GAGTGGCTGC GGGACCTGCC GCGGGAGGTG TGCCTGTGCA CCAGCACCGT GCCTGGCCTG 180
GCTTACGGCA TCTGCGCGGC GCAGAGGATC CAACAGGGCA CCTGGATCGG GCCCTTCCAG 240
GGCGTGCTCC TGCCCCCAGA GAAGGTGCAG GCGGGCGCCG TGAGGAACAC GCAGCATCTC 300
TGGGAGATAT ATGACCAGGA TGGGACACTA CAGCACTTTA TTGATGGTGG GGAACCTAGT 360
AAGTCGAGCT GGATGAGGTA TATCCGATGT GCAAGGCACT GCGGAGAGCA GAATCTAACA 420
GTAGTTCAGT ACAGGTCGAA TATATTCTAC CGAGCCTGTA TAGATATCCC CAGGGGCACC 480
GAGCTTCTGG TGTGGTACAA TGACAGCTAT ACGTCTTTCT TTGGGATCCC CTTACAATGC 540
ATTGCCCAGG ATGAAAACTT AAATGTCCCT TCGACGGTAA TGGAAGCCAT GTGCAGACAG 600
GACGCCCTGC AGCCCTTCAG CAAGAGCAGC AAGCTCTCCC CGGGCCCCCC GCAGCGCTCC 660
GTCGTGTTCC CACAGACCCC GTGCAGCAGG AACTTCTCTC TCCTGGATAA GTCTGGGCCC 720
ATTGACTCGG GATTTAATCA AATCAACGTG AAAAACCAGC GAGTCCTTGC GAGCCCGACC 780
TCCACAAGCC AGCTGCACTC GGAGTTCAGT GACTGGCATC TCTGGAAATG TGGGCAGTGC 840
TTTAAGACTT TCACCCAGCG GATCCTCTTA CAGATGCACG TGTGCACGCA GAACCCCGAC 900
AGACCCTACC AATGCGGTCA CTGCTCCCAG TCCTTTTCCC AACCTTCAGA GCTGAGGAAC 960
CACGTGGTCA CTCACTCCAG TGACCGGCCT TTCAAGTGCG GCTACTGTGG TCGTGCCTTT 1020
GCCGGGGCCA CCACCCTCAA CAACCACATC CGAACCCACA CTGGAGAAAA GCCCTTCAAG 1080
TGCGAGAGGT GTGAGAGGAG CTTCACGCAG GCCACCCAGC TGAGCCGACA CCAGCGGATG 1140
CCCAATGAGT GCAAGCCAAT AACCGAGAGC CCAGAATCAA TCGAAGTGGA TTAA 1195
Sequence Source Ensembl
Orthology
WERAM ID Ensembl Protein ID Species Identity E-value Score
WERAM-Caf-0212 ENSCAFP00000031903.3 Canis familiaris 99 0.0 800
WERAM-Caj-0182 ENSCJAP00000031870.2 Callithrix jacchus 98 0.0 800
WERAM-Paa-0150 ENSPANP00000007800.1 Papio anubis 98 0.0 799
WERAM-Eqc-0022 ENSECAP00000003259.1 Equus caballus 98 0.0 798
WERAM-Loa-0003 ENSLAFP00000000335.4 Loxodonta africana 98 0.0 796
WERAM-Ova-0204 ENSOARP00000020272.1 Ovis aries 98 0.0 795
WERAM-Aim-0176 ENSAMEP00000016566.1 Ailuropoda melanoleuca 98 0.0 794
WERAM-Mum-0220 ENSMUSP00000089513.3 Mus musculus 97 0.0 792
WERAM-Ran-0169 ENSRNOP00000041369.3 Rattus norvegicus 97 0.0 791
WERAM-Myl-0113 ENSMLUP00000009157.2 Myotis lucifugus 97 0.0 790
WERAM-Tut-0079 ENSTTRP00000006439.1 Tursiops truncatus 97 0.0 790
WERAM-Ocp-0043 ENSOPRP00000003686.1 Ochotona princeps 97 0.0 790
WERAM-Sah-0097 ENSSHAP00000011079.1 Sarcophilus harrisii 97 0.0 788
WERAM-Gaga-0057 ENSGALP00000008574.4 Gallus gallus 97 0.0 787
WERAM-Mod-0115 ENSMODP00000016775.4 Monodelphis domestica 97 0.0 783
WERAM-Pes-0066 ENSPSIP00000008417.1 Pelodiscus sinensis 96 0.0 783
WERAM-Fia-0094 ENSFALP00000007850.1 Ficedula albicollis 96 0.0 780
WERAM-Anc-0027 ENSACAP00000003308.3 Anolis carolinensis 91 0.0 760
WERAM-Mae-0109 ENSMEUP00000010466.1 Macropus eugenii 94 0.0 753
WERAM-Sus-0105 ENSSSCP00000015146.2 Sus scrofa 92 0.0 738
WERAM-Tag-0018 ENSTGUP00000001146.1 Taeniopygia guttata 96 0.0 711
WERAM-Orn-0168 ENSONIP00000017375.1 Oreochromis niloticus 82 0.0 693
WERAM-Soa-0070 ENSSARP00000006897.1 Sorex araneus 82 0.0 639
WERAM-Xim-0064 ENSXMAP00000005547.1 Xiphophorus maculatus 33 1e-40 164
WERAM-Dar-0018 ENSDARP00000015394.5 Danio rerio 33 3e-38 156
WERAM-Bot-0054 ENSBTAP00000002795.5 Bos taurus 29 2e-37 153
WERAM-Fec-0217 ENSFCAP00000016661.1 Felis catus 33 4e-36 149
WERAM-Chs-0202 ENSCSAP00000013264.1 Chlorocebus sabaeus 28 6e-36 149
WERAM-Dan-0153 ENSDNOP00000019431.1 Dasypus novemcinctus 29 5e-35 145
WERAM-Poa-0137 ENSPPYP00000017162.1 Pongo abelii 28 5e-35 145
WERAM-Orla-0069 ENSORLP00000008922.1 Oryzias latipes 36 8e-35 145
WERAM-Pof-0242 ENSPFOP00000019968.2 Poecilia formosa 33 1e-34 144
WERAM-Mam-0029 ENSMMUP00000005026.2 Macaca mulatta 28 3e-34 143
WERAM-Pat-0178 ENSPTRP00000036745.1 Pan troglodytes 34 3e-34 143
WERAM-Hos-0119 ENSP00000253008.2 Homo sapiens 34 3e-34 143
WERAM-Gaa-0177 ENSGACP00000022065.1 Gasterosteus aculeatus 34 4e-34 143
WERAM-Gog-0123 ENSGGOP00000010306.2 Gorilla gorilla 34 5e-34 142
WERAM-Tar-0225 ENSTRUP00000047797.1 Takifugu rubripes 34 6e-34 142
WERAM-Orc-0183 ENSOCUP00000016681.2 Oryctolagus cuniculus 29 8e-34 142
WERAM-Gam-0121 ENSGMOP00000012620.1 Gadus morhua 34 1e-33 141
WERAM-Lac-0168 ENSLACP00000019977.1 Latimeria chalumnae 34 1e-33 141
WERAM-Asm-0083 ENSAMXP00000008799.1 Astyanax mexicanus 34 1e-33 141
WERAM-Otg-0085