WERAM Information


Tag Content
WERAM ID WERAM-Asm-0126
Ensembl Protein ID ENSAMXP00000012556.1
Gene Name brpf3b
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSAMXG00000012209.1 ENSAMXT00000012556.1 ENSAMXP00000012556.1
Status Unreviewed
Classification
Type Family E-value Score Start End
Me_Reader PWWP 5.40e-21 74.7 1109 1190
Ac_Reader Bromodomain 1.50e-20 73.3 622 689
Me_Reader PHD 2.60e-08 34.2 248 389
Organism Astyanax mexicanus
Domain Profile
  Me_Reader PWWP

              PWWP.txt    1 agdLVwaKlkgYpwWPalvis.................ppleakkl...ktqeaeenkylVlFFgnkherawvkrkklvpys 62  
++dLVwaK++gYp++Pal+i+ pp ++++l ++ea e+++lVlFF+nk++++w++r+kl p++
ENSAMXP00000012556.1 1109 PLDLVWAKCRGYPSYPALIIDpdmpeegllhngvpipvPPADVLRLgdqRQEEAGEKLFLVLFFDNKRTWQWLPRDKLLPLG 1190
58************************************99***99999788899**************************97 PP

  Ac_Reader Bromodomain

             BROMO.txt   1 kehevsepFrepvdpqleipdYydiikePmdLstikerleegnYsspeefvkDvrlifnNakaynenks 69 
+e++ +e+F +pvd+ +e+pdY + + +Pmd+st++++le+++Y+s++++ +D++l++ N+ yn +++
ENSAMXP00000012556.1 622 QEKDSAEIFAQPVDL-KEVPDYLEFVSQPMDFSTMRSKLEAHKYRSILDLEADFNLMIANCLLYNAKDT 689
578999*********.7************************************************9987 PP

  Me_Reader PHD

               PHD.txt   2 tiClvC.gkddegekemvqCdeCddwfHlkCvklplsslpegkswyCpsCke 52 
+C vC +++ +++ ++ Cd C+ ++H++C+++p +peg +w+C+ C +
ENSAMXP00000012556.1 248 AFCSVClDDECLNSNVILFCDICNLAVHQECYGVP--YIPEG-QWLCRCCLQ 296
69****66777888889******************..*****.*****9975 PP
PHD.txt 3 iClvCgkddegekemvqCde..CddwfHlkCvk 33
+C++C++++ g+ +qC + C ++fH++C +
ENSAMXP00000012556.1 359 TCYLCKQKGRGA--SIQCHKanCYTAFHVTCAQ 389
7****8888886..7*****9**********87 PP

Protein Sequence
(Fasta)
MRKPRRRGGL PGGLGNSRGG GSGGRGSAQP RSPSPYRLKV SPTRETLTYA QAQKMVEVDL 60
DGRLHRISIF DPLPIITEDE MTAQDIAECN SNKENTEQTS ASSAANLSRR TASNKNKKKD 120
IKNAYISILN HFPSSQGQSH SQHGNHCPLP KPTFRVLDSF VPTDAPPLPS AYYRYMEKSQ 180
EELENEAEYD MDEEDVSWLE MVNEKRTSEG QPIVSPDTFE LLMDRMEKES FLESRSQVPS 240
QSSIDEDAFC SVCLDDECLN SNVILFCDIC NLAVHQECYG VPYIPEGQWL CRCCLQSPSR 300
PVDCVLCPNR GGAFKQTSDG RWAHVVCAIW IPEVCFANTV FLEPVEGVDN IPPARWKLTC 360
YLCKQKGRGA SIQCHKANCY TAFHVTCAQR AGLFMKIDPV RETTVNGTTF SVKKTAFCEA 420
HSPEQKEGSD DEETGGRVVG GRANRGSSAY VPTPQLKKSG RSNKKEEESP KKKGKKSQEV 480
ISKKLTTPVV AVPEIPSNRL NKVFKGIIMQ KKNYFMQRLH KYWLLKRQSR NGVPLIRRLH 540
SHLQAQKSAD QAEPDEKVSA VREELKYWQK LRHDLERARL LVELIRKREK LKREQMKVQQ 600
AVMELQLTPA LMLQRSTLDQ LQEKDSAEIF AQPVDLKEVP DYLEFVSQPM DFSTMRSKLE 660
AHKYRSILDL EADFNLMIAN CLLYNAKDTV FHRAAVRLRE LGGAILRHAQ RQAQNTGLDP 720
NTGMHLPESP HKNDYYRCTL EDVDTLLDPE NRLHMTAEDQ LKELLDKLDV VTSMRCSGAR 780
TRRIRLLRKE INNVRYRRNS HLSNGDVKEE DEDEDEDEED KEMDIENNLS SSSDKDDCKS 840
TPPPTLEPSG LALSPPPGDT PQDPPTLRPM TADPKISSSC PSEALSRSSE RREAETEPEP 900
EADVVSQNRL LDTPPVLSPS EGKLLNGLSS SSTPSPSPTR PVSGGVGRRT SVLFRKAKNG 960
VKLQRERDSQ LQNGSNGESK PPSLSLSCSC SSTPILYSSS SSSNSSSIFN SSSSSNSSIN 1020
IIIIISRSIS RSSIFCTLTN GFKKHKDGGS DSESSPSPIL KKEIVLPPKK SRGKPALSKV 1080
PFLETVNGDS DYTGPVDMLS IESDAELEPL DLVWAKCRGY PSYPALIIDP DMPEEGLLHN 1140
GVPIPVPPAD VLRLGDQRQE EAGEKLFLVL FFDNKRTWQW LPRDKLLPLG MDDTVDKLRL 1200
MEGRKTSIRK SVQVAYDRAM MHLSRVRGDH GFVGSNFL 1238
Nucleotide Sequence
(Fasta)
ATGAGAAAGC CACGCCGGAG GGGGGGTCTG CCTGGGGGTT TGGGGAACAG TAGAGGAGGA 60
GGTAGTGGAG GTAGAGGGTC AGCACAGCCC CGCTCCCCGT CCCCCTACAG GCTCAAAGTT 120
TCCCCGACGC GAGAGACCCT GACTTACGCC CAGGCACAGA AGATGGTAGA AGTAGATCTG 180
GACGGTCGCC TGCACCGGAT CAGCATCTTC GACCCGCTGC CCATCATCAC AGAAGACGAG 240
ATGACTGCTC AGGACATCGC AGAGTGCAAC AGCAACAAGG AAAACACAGA GCAGACGTCC 300
GCGTCCAGCG CGGCCAACCT GAGCCGCAGG ACCGCCAGCA ATAAAAACAA AAAGAAGGAC 360
ATTAAGAATG CGTACATTTC TATACTGAAC CACTTCCCCA GCTCTCAAGG ACAGTCTCAC 420
TCGCAGCACG GTAACCACTG CCCCTTACCC AAGCCCACTT TTAGGGTGCT AGATTCTTTT 480
GTACCTACGG ATGCCCCCCC TCTACCCTCA GCCTACTACC GCTACATGGA GAAGTCTCAA 540
GAGGAGCTGG AGAACGAGGC TGAGTACGAC ATGGACGAGG AGGACGTTTC CTGGCTGGAG 600
ATGGTGAACG AGAAGCGGAC GTCCGAGGGT CAGCCAATTG TTTCGCCGGA CACTTTTGAA 660
CTGCTGATGG ACCGTATGGA GAAGGAGTCG TTCCTGGAGT CGAGGAGCCA GGTGCCTTCT 720
CAGAGCTCCA TCGACGAGGA CGCTTTCTGC TCTGTCTGCC TGGACGACGA GTGCCTCAAC 780
AGCAATGTCA TCCTCTTCTG TGACATCTGC AACCTGGCCG TGCACCAAGA GTGTTACGGG 840
GTTCCTTACA TCCCTGAGGG TCAGTGGCTG TGCCGCTGCT GCCTCCAGTC CCCCTCCCGC 900
CCTGTGGACT GCGTGCTTTG CCCCAATCGG GGTGGAGCCT TTAAACAGAC CAGCGACGGA 960
CGATGGGCAC ACGTGGTTTG TGCCATTTGG ATCCCGGAGG TGTGCTTCGC CAACACTGTC 1020
TTTTTAGAGC CTGTGGAGGG AGTGGACAAC ATCCCTCCGG CCAGGTGGAA GCTGACGTGC 1080
TACCTGTGCA AGCAGAAAGG TCGTGGCGCG TCCATCCAGT GCCACAAGGC CAACTGCTAC 1140
ACAGCGTTCC ACGTCACCTG TGCCCAGAGA GCAGGTCTCT TCATGAAAAT CGACCCGGTG 1200
CGGGAGACCA CTGTGAACGG AACAACGTTT TCAGTGAAGA AGACGGCGTT CTGCGAGGCT 1260
CACTCGCCCG AACAGAAAGA GGGCTCTGAT GACGAAGAGA CAGGGGGGAG GGTGGTGGGA 1320
GGACGGGCCA ACAGGGGGAG CAGTGCGTAT GTCCCGACGC CACAGTTAAA AAAGTCGGGA 1380
CGGAGCAATA AGAAAGAGGA GGAGAGTCCC AAGAAAAAGG GGAAGAAGAG CCAAGAAGTA 1440
ATATCTAAAA AGTTAACCAC ACCTGTGGTT GCCGTGCCAG AGATACCTTC AAATAGGTTG 1500
AACAAAGTTT TTAAAGGAAT TATAATGCAA AAAAAGAACT ATTTTATGCA GAGGTTGCAC 1560
AAATATTGGT TACTGAAGCG TCAATCACGC AACGGAGTGC CTCTCATTCG CCGGCTGCAC 1620
TCTCATCTGC AGGCCCAGAA GAGTGCAGAT CAGGCCGAGC CAGATGAAAA AGTGAGCGCT 1680
GTAAGAGAAG AGCTGAAATA CTGGCAGAAG TTGCGGCATG ATCTGGAGAG AGCCCGGCTT 1740
CTGGTGGAGC TCATCCGTAA GAGAGAGAAA CTAAAGAGAG AGCAGATGAA GGTGCAGCAG 1800
GCAGTGATGG AGCTGCAGCT GACTCCTGCA CTGATGCTGC AGCGCTCCAC CCTGGATCAG 1860
CTGCAGGAGA AAGACTCCGC TGAGATCTTC GCTCAGCCTG TCGATCTCAA AGAGGTTCCT 1920
GATTACCTGG AGTTCGTCTC TCAGCCCATG GATTTCTCCA CCATGAGGTC TAAGCTGGAA 1980
GCGCACAAAT ACCGCTCGAT CTTGGACCTG GAGGCGGATT TTAACCTCAT GATCGCGAAC 2040
TGTCTGCTGT ATAATGCTAA AGATACGGTG TTCCACCGCG CTGCAGTGCG ACTGCGGGAG 2100
CTAGGTGGCG CTATACTGCG GCACGCGCAA CGGCAGGCTC AGAATACGGG GCTGGACCCC 2160
AATACAGGCA TGCACCTCCC AGAGTCTCCG CATAAGAACG ACTACTACCG CTGTACGCTG 2220
GAGGACGTGG ACACGCTGCT GGACCCGGAG AACAGGCTGC ACATGACAGC AGAGGATCAG 2280
CTGAAGGAAC TACTGGATAA GCTGGACGTG GTGACATCCA TGCGCTGCAG CGGCGCAAGA 2340
ACGCGCCGCA TCCGGCTCCT GCGCAAAGAG ATCAACAACG TCCGCTACCG CCGCAACTCG 2400
CACCTCTCCA ACGGAGACGT GAAGGAGGAA GACGAGGACG AAGATGAGGA TGAGGAAGAC 2460
AAAGAGATGG ACATTGAAAA CAACCTTTCT TCATCCTCGG ACAAAGATGA TTGTAAATCC 2520
ACCCCACCTC CAACCCTGGA GCCGTCAGGC CTGGCCTTAT CCCCTCCTCC CGGGGACACC 2580
CCCCAGGACC CCCCCACTCT ACGTCCAATG ACTGCTGACC CAAAGATCTC GTCCTCCTGT 2640
CCGTCTGAAG CTCTGAGTCG GAGCAGTGAG AGGAGGGAAG CCGAGACAGA ACCGGAACCA 2700
GAGGCAGATG TTGTATCTCA GAACAGATTG CTGGACACGC CTCCGGTTCT GTCCCCCAGC 2760
GAGGGCAAGC TGCTGAACGG CCTCTCCTCG TCCTCCACCC CGTCCCCGTC CCCGACCCGG 2820
CCCGTCTCCG GGGGAGTGGG ACGCCGCACC TCTGTCCTCT TCAGGAAAGC GAAAAACGGC 2880
GTGAAGCTGC AGCGCGAGAG AGACAGTCAG CTGCAGAACG GCAGCAACGG GGAGAGCAAA 2940
CCACCCTCGC TCTCGCTCAG CTGCAGCTGC AGCAGCACAC CCATTTTGTA TAGTAGTAGT 3000
AGTAGTAGTA ACAGTAGTAG TATTTTTAAT AGTAGTAGTA GTAGTAACAG TAGTATTAAT 3060
ATTATTATTA TTATTAGTCG TAGTATTAGT AGGAGTAGTA TTTTTTGTAC TCTCACTAAT 3120
GGATTCAAAA AGCACAAAGA TGGAGGATCT GACTCTGAGA GCAGCCCCTC CCCCATACTC 3180
AAGAAGGAAA TTGTTTTGCC ACCAAAAAAA AGTCGAGGAA AACCTGCGCT GTCCAAAGTT 3240
CCGTTCTTAG AGACTGTTAA TGGAGATTCT GACTACACTG GTCCAGTGGA CATGCTGTCT 3300
ATAGAAAGTG ATGCTGAACT GGAGCCTCTG GACCTGGTGT GGGCCAAGTG TAGGGGTTAC 3360
CCGTCCTACC CTGCTCTGAT CATAGATCCA GACATGCCAG AGGAGGGTCT GCTGCATAAT 3420
GGAGTGCCTA TCCCCGTCCC TCCTGCGGAT GTGCTGCGGC TTGGGGACCA GAGGCAGGAG 3480
GAGGCTGGCG AGAAACTCTT CCTCGTCCTC TTCTTCGACA ACAAGCGCAC CTGGCAATGG 3540
TTACCACGAG ACAAGCTGCT ACCACTGGGC ATGGACGACA CGGTGGACAA ACTGCGCCTG 3600
ATGGAGGGTC GGAAGACCAG CATCCGGAAG TCCGTGCAGG TGGCGTACGA CCGAGCCATG 3660
ATGCACCTCA GCCGAGTACG AGGGGACCAC GGCTTCGTCG GCTCCAACTT CTTATAGAGT 3720
CCACCAAAGC CTCAGCACAC GTCACTATCC TCACTATCCA TTCTCCTCCT CATCACTACT 3780
ACTACTACTA CTCAAATACC ACTCGCACAG GCGGCTGCGT CCCAATCCCT TCGCTCGCTC 3840
CCTCTCTTTC TCCCTTGTGC CCTTGCGCCC TTCCTCTCTC CCTCTACTGG ACATGAAGGG 3900
TACTGTTCAG GGAGTGGAGT CACTCAAACA CAGTGCACTG TCCACTGACC GTCTCAGCAG 3960
GGACGCCTCT CATTTTTTTC CAGTGTCAAG AAGAAGGAGT GTCAGCCATG AAATCGTAGT 4020
TTGTTTAAGG TTTTTAATCC CCCTTAGGGC TTAAAGTGAG CGTGAGTTGT GCGTGGGGGG 4080
GAGCTTTAAA CAAGCATACG TGCAAATATG TGTGTGTGTT TGTGTTTTTT AAACTAGTGT 4140
CACTTTAAAT CTGGTGGTTT GGAGAGTCTG GACCATCCGA AGGCTTGCTG TCGACGATGG 4200
ACGTAGAGCA GAGTCTGTTT TCTGACAATG ATTCATTTAT AAGACGAATG AACGAGTCGG 4260
TGAATCGGAG TGAATCAGCT GGAAGCGAGC GCGTTCCAAC GTATGAATGA ATCACTGCCA 4320
TTTTCTTATG ATAGCTTTTT ACTTTTTAAC GTTTTACAAA CCACTTCTAT TTCTTGTATA 4380
TTGTAAAGAC GACACTTGTG CGTGCGTGCA TGTGCGTGTG TGTGTGTGTG TGTATATAAG 4440
TACATTTCTT TCTCTTTTTA TTTTCTTTTT TTTTTGTCGT ACAATATCTA ATTTAATTTG 4500
AGTCTTGTAT ATTGTGAATT CAATCACCTG GATGTATGAA GAAGTCAGAT CTCTTCTGTA 4560
CATATTTGTA AAAAAGAAAA AAACAAACAA AAAAAAACAA ACCAACATCA AGAAAATGAA 4620
AGAATGAAAG AAAGAATATC GAATCATTGA ATCACTTACT TTTGCTGCAA AGTGTGTGTG 4680
TTCCGCTTGT CTTCGATGTC AGATTGTGAG AATACACTCA TATGTTCGTA TGTATGTATG 4740
TATGTATGTA AGGTATACAC ATACATCGTA CGATGTACAT TTATGTATGA TACGCAGCAG 4800
CCAGTTGTTA TATGGTTCTA TCATTTTTGA TACACAGAAA TGTAATTTAT TTATGGATCG 4860
CAAAGAGATA GAGATAATTA AATTATATAT TGGTTGAAGA AGAATCGAAT CAAATATCGT 4920
ATTTAAGATG AACTATTGAA TAGGGGTTTT AACACGAGAT GGGCTTTGAG ACTTTATGGC 4980
TTTGTTTTTA TTATGTTCAG CTTTTCAGAT GAAATGCTTT GTTGGAGGAT GCATTATTCA 5040
CAAACAAACA AACAAAGAGA CAGACAGACA GACAGACAGT AAACCCTTCT TTTTTCTTTT 5100
TTTGATCACA TTTTTTGCAC CATTAAAGCG CAGAGCCTTG TATTTATTGT AGAAACTTGC 5160
TGAGCTCTAG GACCTGTTTA TAAAGATGGA GCTGAGAGAG AAATTTTAAG CTTGTACAAA 5220
CTGCAGATTT TACCTACTCG CCAAATAACC AGTCTCAAAC AGTATTTTCT CATGTGGGGA 5280
AATAAATGTT CTATTGAATC TCTTAATGCT CTTGTCCGTC TGTTTTCTGC AACATAAAAT 5340
GTGAAATCTC ATCCTCTTTC TTCTCTGATT TTAAAGCACT ATTTTACCAC TCTTTGTTAA 5400
ATTCTCTTCG GCTCTTTGAG CAGACTCTAC TCCCTCGACC CGTGACTCAG CGGTGGGAGT 5460
ACTGAAGGGA TGATTCAGCT TGTTTTACAT GGCTCCAACA GAAGTGGCAT CAAGTGGAAT 5520
CTGAGTGAGA CCAGATAAAC GTGACCAAAC TTCAGCTTTG CTTGTCAGGA CAGCAGAGAA 5580
TTCAAGGGCC AAGGTCACTT CACTTTGTCT TCTTTTGTTT TTACTTAAAT TGATCAAGCG 5640
TTTAAACATT ATAATCCTTG TTTCTACACC CATTAGCCAT TTTTGTAGTT TTGTAATCAC 5700
AGACTGTAGT CCTGTATCTG TTCCTAGAGA CACCTTATGG TCTTCGCTTC ACTCTATTCA 5760
TCAATGGTCA AGACCACACA GGACCATTAT TGCCTCTTTT TGAACATCGC AGAGTAGCAT 5820
CACAGCGCTA ATGCTCGGAG GAAAGCACAG CGACTCTGGT GGTTCTGATA CATCAGCTCA 5880
CAGACGCAGC CTTGTGCTGA TCCACATCAC CCTAGAAGTG ATGAGGGGAA AGAGAGGGCG 5940
CCATCTACTG TACTGTACCC ACCCAGAGAG AGCACGACAA ATTGTCCTCT CTTAGGGCTC 6000
CGGCAGCTAA TAACAAGCTG CATGACCTGG ATTCAAACAC GCTCCCCATC GTAATGGCAG 6060
CGCTTTAGAC TGCTAGACC
Sequence Source Ensembl
Orthology
WERAM ID Ensembl Protein ID Species Identity E-value Score
WERAM-Dar-0165 ENSDARP00000116871.2 Danio rerio 73 0.0 1540
WERAM-Pof-0194 ENSPFOP00000016252.2 Poecilia formosa 62 0.0 1337
WERAM-Gaa-0049 ENSGACP00000006514.1 Gasterosteus aculeatus 61 0.0 1313
WERAM-Leo-0103 ENSLOCP00000013600.1 Lepisosteus oculatus 73 0.0 1123
WERAM-Orn-0044 ENSONIP00000004970.1 Oreochromis niloticus 71 0.0 1118
WERAM-Tar-0101 ENSTRUP00000020960.1 Takifugu rubripes 65 0.0 1103
WERAM-Orla-0039 ENSORLP00000004868.1 Oryzias latipes 71 0.0 1102
WERAM-Xim-0211 ENSXMAP00000017026.1 Xiphophorus maculatus 71 0.0 1096
WERAM-Ten-0180 ENSTNIP00000017811.1 Tetraodon nigroviridis 70 0.0 1055
WERAM-Gaga-0007 ENSGALP00000001121.4 Gallus gallus 67 0.0 1017
WERAM-Fia-0052 ENSFALP00000003674.1 Ficedula albicollis 67 0.0 1015
WERAM-Lac-0016 ENSLACP00000002326.1 Latimeria chalumnae 67 0.0 1015
WERAM-Anp-0002 ENSAPLP00000000272.1 Anas platyrhynchos 66 0.0 1012
WERAM-Pes-0055 ENSPSIP00000007495.1 Pelodiscus sinensis 66 0.0 1007
WERAM-Meg-0003 ENSMGAP00000000252.2 Meleagris gallopavo 64 0.0 999
WERAM-Mum-0217 ENSMUSP00000004985.9 Mus musculus 65 0.0 997
WERAM-Caj-0165 ENSCJAP00000029416.2 Callithrix jacchus 66 0.0 994
WERAM-Sah-0064 ENSSHAP00000007688.1 Sarcophilus harrisii 65 0.0 994
WERAM-Ran-0166 ENSRNOP00000041680.3 Rattus norvegicus 65 0.0 993
WERAM-Cap-0116 ENSCPOP00000009174.2 Cavia porcellus 66 0.0 987
WERAM-Ora-0025 ENSOANP00000003691.2 Ornithorhynchus anatinus 65 0.0 985
WERAM-Mod-0118 ENSMODP00000031361.3 Monodelphis domestica 64 0.0 983
WERAM-Anc-0176 ENSACAP00000016633.3 Anolis carolinensis 64 0.0 979
WERAM-Ova-0135 ENSOARP00000014056.1 Ovis aries 65 0.0 979
WERAM-Tag-0025 ENSTGUP00000001669.1 Taeniopygia guttata 65 0.0 971
WERAM-Soa-0089 ENSSARP00000008498.1 Sorex araneus 63 0.0 951
WERAM-Xet-0184 ENSXETP00000061483.1 Xenopus tropicalis 63 0.0 950
WERAM-Bot-0125 ENSBTAP00000017711.5 Bos taurus 63 0.0 932
WERAM-Ect-0118 ENSETEP00000013907.1 Echinops telfairi 61 0.0 884
WERAM-Loa-0006 ENSLAFP00000000466.3 Loxodonta africana 58 0.0 848
WERAM-Mup-0026 ENSMPUP00000002462.1 Mustela putorius furo 58 0.0 845
WERAM-Caf-0005 ENSCAFP00000001030.2 Canis familiaris 58 0.0 842
WERAM-Fec-0133 ENSFCAP00000012198.3 Felis catus 58 0.0 841
WERAM-Ere-0020 ENSEEUP00000001322.1 Erinaceus europaeus 58 0.0 841
WERAM-Eqc-0164 ENSECAP00000017970.1 Equus caballus 57 0.0 840
WERAM-Dan-0136 ENSDNOP00000019441.1 Dasypus novemcinctus 58 0.0 834
WERAM-Otg-0134 ENSOGAP00000011869.2 Otolemur garnettii 56 0.0 831
WERAM-Tut-0157 ENSTTRP00000013157.1 Tursiops truncatus 57 0.0 825
WERAM-Nol-0014 ENSNLEP00000001635.1 Nomascus leucogenys 58 0.0 820
WERAM-Pat-0121 ENSPTRP00000025033.4 Pan troglodytes 58 0.0 818
WERAM-Hos-0057 ENSP00000384076.1 Homo sapiens 58 0.0 818
WERAM-Paa-0126 ENSPANP00000013603.1 Papio anubis 58 0.0 818
WERAM-Myl-0145 ENSMLUP00000011787.2 Myotis lucifugus 55 0.0 816
WERAM-Mam-0004 ENSMMUP00000000744.2 Macaca mulatta 58 0.0 816
WERAM-Chs-0055 ENSCSAP00000001441.1 Chlorocebus sabaeus 58 0.0 815
WERAM-Orc-0028 ENSOCUP00000002977.3 Oryctolagus cuniculus 55 0.0 812
WERAM-Poa-0121 ENSPPYP00000015298.2 Pongo abelii 55 0.0 811
WERAM-Ict-0026 ENSSTOP00000001851.2 Ictidomys tridecemlineatus 55 0.0 809
WERAM-Aim-0183 ENSAMEP00000017228.1 Ailuropoda melanoleuca 55 0.0 809
WERAM-Sus-0081 ENSSSCP00000012306.2 Sus scrofa 55 0.0 808
WERAM-Ocp-0023 ENSOPRP00000002046.1 Ochotona princeps 54 0.0 805
WERAM-Dio-0101 ENSDORP00000010350.1 Dipodomys ordii 55 0.0 805
WERAM-Ptv-0134 ENSPVAP00000011359.1 Pteropus vampyrus 55 0.0 790
WERAM-Gam-0197 ENSGMOP00000018873.1 Gadus morhua 52 0.0 774
WERAM-Mae-0032 ENSMEUP00000002473.1 Macropus eugenii 53 0.0 767
WERAM-Chh-0014 ENSCHOP00000001384.1 Choloepus hoffmanni 56 0.0 749
WERAM-Mim-0137 ENSMICP00000013900.1 Microcebus murinus 52 0.0 739
WERAM-Cii-0018 ENSCINP00000007020.3 Ciona intestinalis 49 0.0 689
WERAM-Cis-0008 ENSCSAVP00000000906.1 Ciona savignyi 48 0.0 653
WERAM-Gog-0148 ENSGGOP00000013085.2 Gorilla gorilla 71 4e-171 600
WERAM-Tas-0080 ENSTSYP00000007958.1 Tarsius syrichta 71 7e-170 595
WERAM-Drm-0049 FBpp0088092 Drosophila melanogaster 46 8e-170 595
WERAM-Tub-0023 ENSTBEP00000002714.1 Tupaia belangeri 55 9e-159 558
WERAM-Prc-0026 ENSPCAP00000002140.1 Procavia capensis 61 1e-139 495
WERAM-Crn-0022 AAW44024 Cryptococcus neoformans 40 1e-115 415
WERAM-Miv-0018 MVLG_02627T0 Microbotryum violaceum 41 1e-113 409
WERAM-Lab-0029 EDR14442 Laccaria bicolor 39 4e-109 394
WERAM-Spr-0043 CBQ71306 Sporisorium reilianum 36 5e-106 383
WERAM-Pem-0069 ENSPMAP00000007494.1 Petromyzon marinus 62 2e-102 371
WERAM-Pug-0038 EHS64083 Puccinia graminis 36 1e-99 362
WERAM-Vip-0098 ENSVPAP00000009227.1 Vicugna pacos 57 1e-82 306
WERAM-Asni-0016 CADANGAP00005461 Aspergillus niger 31 1e-79 296
WERAM-Aso-0016 CADAORAP00002251 Aspergillus oryzae 32 1e-79 295
WERAM-Asf-0001 CADAFLAP00000289 Aspergillus flavus 32 2e-79 295
WERAM-Tum-0028 CAZ85192 Tuber melanosporum 35 5e-79 293
WERAM-Asfu-0042 CADAFUAP00009619 Aspergillus fumigatus 32 7e-79 293
WERAM-Asc-0003 CADACLAP00000549 Aspergillus clavatus 31 1e-78 292
WERAM-Zyt-0018 Mycgr3P40869 Zymoseptoria tritici 33 4e-77 288
WERAM-Ast-0022 CADATEAP00007043 Aspergillus terreus 31 4e-77 287
WERAM-Usm-0037 UM06029P0 Ustilago maydis 46 6e-76 283
WERAM-Lem-0038 CBX94513 Leptosphaeria maculans 33 2e-75 282
WERAM-Asn-0029 CADANIAP00007460 Aspergillus nidulans 31 4e-74 277
WERAM-Pyt-0019 EFQ90949 Pyrenophora teres 32 7e-74 276
WERAM-Phn-0007 SNOT_00794 Phaeosphaeria nodorum 33 1e-72 272
WERAM-Scs-0028 EDO04650 Sclerotinia sclerotiorum 32 2e-72 272
WERAM-Coi-0025 EAS33674 Coccidioides immitis 32 2e-72 272
WERAM-Map-0023 MAPG_06864T0 Magnaporthe poae 32 9e-70 263
WERAM-Gag-0007 GGTG_01676T0 Gaeumannomyces graminis 32 1e-69 263
WERAM-Trv-0019 EHK16654 Trichoderma virens 37 1e-69 263
WERAM-Mel-0009 EGG11957 Melampsora laricipopulina 53 3e-69 261
WERAM-Cae-0012 F42A9.2.2 Caenorhabditis elegans 31 4e-68 257
WERAM-Nec-0004 EFNCRP00000000441 Neurospora crassa 30 5e-68<