WERAM Information


Tag Content
WERAM ID WERAM-Asg-0023
Ensembl Protein ID AAS53055
Gene Name
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
AGOS_AER375C AAS53055 AAS53055
Status Unreviewed
Classification
Type Family E-value Score Start End
Ac_Reader Bromodomain 7.70e-15 52.7 1198 1266
Organism Ashbya gossypii
Domain Profile
  Ac_Reader Bromodomain

  BROMO.txt    3 hevsepFrepvdpqleipdYydiikePmdLstikerleegnYsspeefvkDvrlifnNakaynenkssvq 72  
h+ ++F++ + ++pdYy++i +P+ ++ti ++ ++g Y+s+ + D++ +f+Nak yn+++s v+
AAS53055 1198 HSRTDIFEKLPSR-RDYPDYYQLIANPVSIDTILRNTKKGVYTSMVSVRSDFQTMFDNAKFYNQEGSWVY 1266
7788999666666.49*************************************************99886 PP

Protein Sequence
(Fasta)
MSTTADYAAV DGAGSVGGQE KAYADALVIP RPETKDQLEQ LLYRYRAIIA TPEKNQLEID 60
AIEQVFTTVS EQQELYVQRL AELRKAVQRD VGYDSSLLKK QLISLQLLSR DMDLPVELLQ 120
DLETVLQPQE SSPNPPTDIK PIQLSLDFTA NAEKFGLKDK FCSIGYQKTS SKLGEYKMET 180
AISARIAQRI HELETLPSNL GTYSLDDALE FITKGDVPSS IDNLKIKALV ELKALKLLTK 240
QKSLRQKLIS NVTSQSHQTI PYLRDSQYTM AAQRSINVRM KVIVPQTARL AEELERQQLL 300
EKRKRERNLH RQKVSQIVEF IQQRQQDFSS HRERAAQFGR ICATLHSQME KEEQRRIERT 360
AKQRLAALKS NDEEAYLKLL DQTKDTRITH LLKQTNSFLD SLAQAVRVQQ NEAKLRRGEE 420
IPPVTDEERE KIDYYEVAHR IKEKVEKQPS ILVGGTLKEY QIRGLEWMVS LYNNHLNGIL 480
ADEMGLGKTI QSISLITYLY EVKKDSGPFL VIVPLSTITN WTLEFEKWAP SLTTVIYKGT 540
PNQRRSLQHQ VRIGDFDVLL TTYEYIIKDR SLLAKHEWSH MIIDEGHRMK NAQSKLSYTL 600
THYYKTRHRL ILTGTPLQNN LPELWALLNF VLPKIFNSSK TFDEWFNTPF SNTGGQEKLE 660
LTEEEALLVI RRLHKVLRPF LLRRLKKEVE KDLPDKVEKV VKCKLSGLQH QLYQQMLKHN 720
ALFVGAGTEG ATKGGIKGLN NKIMQLRKIC NHPFVFDEVE GVVNPTRTNS SLLYRVSGKF 780
ELLDRVLPKF KATGHRVLMF FQMTQVMDIM EDFLQMKNLK YMRLDGATKA EERTGMLNAF 840
NAPDSDYFCF LLSTRAGGLG LNLQTADTVI IFDTDWNPHQ DLQAQDRAHR IGQKNEVRIL 900
RLITTDSVEE VILERAMQKL DIDGKVIQAG KFDNKSTAEE QEAFLRRLLE SESNKDDDDQ 960
AELDDVELNE ILARNEAEKE LFDKIDRERV MREQKEAAAR GLKKSLPRLI TLEELPDVFT 1020
EDIEQHLQTG PTAVGRIRER KRVYYDDGLT EEQWLQAVDD DNDTLEEAIK RKREAREKRQ 1080
RKKMGLDTDG LLDETPEPTT PADAEPEPLP EEPVVSSKRP RRPRKASEAL PVSGEHEPPE 1140
IDEPEPKKPK LKVKINLPKL AAEPQPKKRT KKPAETLLSD VQAFIDLLRQ QTDPTDGHSR 1200
TDIFEKLPSR RDYPDYYQLI ANPVSIDTIL RNTKKGVYTS MVSVRSDFQT MFDNAKFYNQ 1260
EGSWVYNDAD YLSNFLSTHF PGRTDAEK 1288
Nucleotide Sequence
(Fasta)
ATGAGCACGA CAGCAGATTA CGCGGCTGTA GATGGCGCGG GCAGCGTCGG CGGCCAGGAG 60
AAGGCATACG CGGACGCGCT GGTTATTCCA CGGCCGGAAA CAAAGGACCA GCTAGAACAG 120
CTGCTGTACC GGTACCGCGC GATCATTGCG ACGCCTGAAA AGAACCAGTT GGAGATAGAT 180
GCGATCGAGC AGGTCTTTAC GACAGTGAGC GAGCAGCAAG AGCTCTATGT TCAGCGGCTC 240
GCAGAGCTAC GCAAGGCTGT ACAGCGTGAT GTTGGCTATG ACTCCTCGTT GCTGAAAAAG 300
CAGCTGATCT CGCTGCAATT GCTGAGTAGA GACATGGACC TTCCTGTGGA ACTGCTGCAG 360
GACCTGGAAA CCGTTCTGCA ACCGCAGGAG AGCTCTCCCA ACCCTCCTAC GGACATCAAA 420
CCCATCCAGC TGTCGCTAGA TTTCACCGCT AATGCTGAGA AATTTGGGCT GAAAGATAAG 480
TTTTGCTCTA TTGGATACCA GAAGACCTCA TCCAAACTAG GCGAATACAA GATGGAAACT 540
GCCATTTCTG CTCGCATTGC GCAACGCATC CACGAACTGG AGACTCTCCC ATCAAATCTA 600
GGCACTTATT CCTTGGACGA TGCGCTGGAG TTCATTACCA AAGGCGACGT CCCCTCCAGC 660
ATAGATAACC TGAAGATAAA AGCTTTAGTG GAGCTGAAGG CTTTGAAGCT GCTGACCAAA 720
CAGAAGTCTT TGAGACAGAA GCTGATTAGC AATGTTACTA GCCAGTCACA CCAGACCATT 780
CCCTATCTCA GAGATTCACA ATACACAATG GCAGCCCAGC GTTCGATCAA TGTTCGCATG 840
AAGGTGATTG TTCCTCAGAC CGCCAGGCTA GCCGAGGAGT TAGAAAGGCA GCAACTTCTG 900
GAAAAGCGTA AACGGGAACG CAACCTGCAC AGGCAAAAGG TGAGCCAGAT TGTGGAATTT 960
ATTCAACAGA GACAGCAAGA TTTCTCTTCT CACCGTGAAA GAGCAGCTCA ATTTGGAAGA 1020
ATATGCGCTA CCTTACATTC TCAGATGGAG AAGGAAGAGC AGAGAAGAAT CGAACGGACG 1080
GCGAAACAGC GTTTGGCAGC CTTAAAATCT AACGATGAGG AAGCTTACTT GAAGTTGCTG 1140
GATCAAACAA AGGACACAAG AATCACGCAC TTATTAAAGC AGACGAATTC CTTCTTAGAT 1200
TCTTTAGCTC AAGCAGTGAG AGTGCAACAA AATGAAGCCA AATTAAGGAG GGGAGAAGAA 1260
ATTCCTCCTG TAACGGACGA AGAAAGAGAA AAGATTGATT ACTACGAGGT AGCTCATAGG 1320
ATTAAAGAGA AAGTTGAGAA GCAGCCTAGC ATACTGGTTG GCGGTACATT GAAGGAGTAC 1380
CAAATACGTG GTCTAGAGTG GATGGTTTCC CTTTATAATA ACCATTTGAA TGGTATTTTG 1440
GCAGATGAAA TGGGTCTCGG TAAGACTATT CAATCTATTT CCTTGATAAC ATATCTGTAT 1500
GAGGTGAAGA AGGATAGTGG GCCTTTCTTA GTCATTGTTC CACTATCTAC AATCACTAAC 1560
TGGACTTTGG AATTTGAAAA ATGGGCACCA AGCTTAACCA CTGTCATCTA CAAGGGTACT 1620
CCGAACCAGA GAAGGTCTCT ACAACATCAA GTCAGGATAG GAGACTTCGA TGTTTTACTC 1680
ACCACGTATG AGTATATTAT TAAGGACCGC TCCCTACTAG CTAAGCATGA GTGGTCTCAT 1740
ATGATTATCG ACGAGGGTCA CAGAATGAAA AATGCTCAGT CGAAATTGTC ATACACTTTG 1800
ACACATTACT ATAAGACAAG ACATAGACTT ATTTTGACTG GTACACCTTT GCAGAACAAT 1860
TTGCCAGAAC TATGGGCTTT GTTGAATTTT GTCTTGCCAA AGATCTTCAA TTCTTCCAAA 1920
ACCTTTGATG AGTGGTTTAA TACACCTTTC TCTAATACTG GTGGCCAAGA AAAACTTGAG 1980
CTTACAGAAG AAGAAGCATT ATTGGTCATC AGAAGATTGC ATAAAGTGCT GCGGCCATTC 2040
TTACTGCGCC GTCTAAAAAA AGAAGTGGAA AAAGACCTGC CTGATAAAGT GGAAAAAGTA 2100
GTCAAGTGCA AATTATCTGG CTTACAGCAT CAATTATATC AGCAGATGTT GAAGCACAAT 2160
GCGCTGTTTG TGGGAGCTGG CACTGAAGGT GCCACGAAGG GCGGCATAAA GGGTTTGAAT 2220
AATAAAATTA TGCAGTTACG GAAAATCTGC AATCATCCAT TCGTATTTGA CGAAGTTGAG 2280
GGGGTTGTAA ATCCGACAAG GACTAACTCA TCCCTATTAT ACAGGGTATC GGGTAAATTT 2340
GAATTGCTAG ATCGTGTGCT ACCAAAGTTT AAAGCCACCG GGCATAGAGT GCTTATGTTC 2400
TTTCAGATGA CTCAAGTAAT GGATATTATG GAGGACTTCC TGCAGATGAA AAATCTGAAA 2460
TACATGCGTT TGGATGGTGC TACTAAGGCG GAGGAACGTA CTGGCATGCT TAACGCCTTC 2520
AATGCTCCGG ACTCAGACTA CTTCTGTTTC CTACTTTCGA CAAGGGCAGG TGGTCTCGGC 2580
CTAAACTTGC AGACGGCCGA TACCGTTATT ATCTTTGACA CAGACTGGAA TCCTCACCAG 2640
GATTTACAGG CTCAGGATAG AGCCCATAGA ATTGGACAAA AAAACGAAGT CAGGATCCTA 2700
CGGCTAATTA CAACAGACTC CGTCGAAGAG GTTATCCTAG AAAGAGCAAT GCAAAAGCTA 2760
GACATTGATG GAAAGGTTAT TCAGGCGGGT AAGTTCGATA ACAAATCTAC TGCCGAAGAA 2820
CAGGAGGCCT TTTTGCGCCG GCTCCTCGAA AGTGAGTCGA ACAAGGACGA TGATGACCAA 2880
GCGGAGTTGG ATGATGTGGA ACTGAACGAA ATCCTAGCAC GTAACGAAGC GGAGAAGGAG 2940
CTTTTTGACA AGATCGACCG CGAACGAGTA ATGCGTGAGC AAAAGGAGGC TGCTGCCCGA 3000
GGCCTGAAGA AGTCCCTTCC TCGTCTGATT ACCCTCGAAG AATTACCGGA TGTGTTCACA 3060
GAGGATATAG AACAGCATCT CCAGACAGGC CCCACCGCAG TGGGCCGTAT TCGCGAACGC 3120
AAACGGGTGT ATTATGATGA TGGTCTCACT GAGGAACAGT GGCTACAAGC TGTTGATGAC 3180
GACAACGATA CTCTCGAGGA GGCTATTAAA CGCAAGCGCG AGGCACGCGA GAAACGTCAG 3240
CGCAAAAAGA TGGGCCTCGA CACCGACGGC TTGCTCGATG AAACCCCAGA GCCAACCACG 3300
CCCGCAGACG CAGAACCAGA GCCGCTGCCG GAGGAGCCCG TAGTTAGCAG CAAACGGCCG 3360
CGCAGGCCAC GCAAGGCATC CGAAGCGCTG CCTGTCTCAG GCGAGCATGA GCCTCCAGAG 3420
ATTGATGAAC CGGAGCCCAA AAAGCCGAAA CTCAAGGTCA AGATCAATCT CCCAAAGCTC 3480
GCCGCAGAAC CCCAGCCCAA GAAGCGTACC AAAAAGCCAG CAGAAACTCT GCTCTCCGAC 3540
GTGCAGGCTT TCATTGATTT GCTGCGACAA CAAACAGACC CGACTGACGG CCACTCGCGC 3600
ACCGACATAT TTGAGAAGCT TCCTTCGCGC CGCGACTACC CCGACTATTA CCAACTAATC 3660
GCCAATCCCG TATCTATCGA TACCATCCTA AGAAACACCA AGAAGGGCGT CTACACCTCC 3720
ATGGTGTCCG TGCGCAGCGA TTTCCAGACC ATGTTCGATA ATGCCAAGTT TTACAACCAG 3780
GAGGGCTCAT GGGTCTACAA CGATGCAGAC TATCTCAGCA ACTTCCTCTC GACCCATTTC 3840
CCTGGTCGCA CGGACGCAGA GAAGTAG 3868
Sequence Source Ensembl
Orthology
WERAM ID Ensembl Protein ID Species Identity E-value Score
WERAM-Sac-0022 YIL126W Saccharomyces cerevisiae 76 0.0 1494
WERAM-Kll-0025 CAG97992 Kluyveromyces lactis 74 0.0 1489
WERAM-Cag-0014 CAG59670 Candida glabrata 75 0.0 1468
WERAM-Kop-0019 CAY69798 Komagataella pastoris 63 0.0 1177
WERAM-Caa-0016 KGT69998 Candida albicans 60 0.0 1119
WERAM-Yal-0005 CAG81616 Yarrowia lipolytica 57 0.0 1052
WERAM-Aso-0019 CADAORAP00003972 Aspergillus oryzae 65 0.0 988
WERAM-Nec-0028 EFNCRP00000006203 Neurospora crassa 66 0.0 988
WERAM-Asfu-0028 CADAFUAP00006226 Aspergillus fumigatus 60 0.0 987
WERAM-Mao-0021 MGG_06388T0 Magnaporthe oryzae 67 0.0 986
WERAM-Asc-0004 CADACLAP00000822 Aspergillus clavatus 60 0.0 985
WERAM-Lem-0011 CBY00787 Leptosphaeria maculans 58 0.0 982
WERAM-Zyt-0031 Mycgr3P74992 Zymoseptoria tritici 59 0.0 979
WERAM-Pyt-0040 EFQ85893 Pyrenophora teres 64 0.0 979
WERAM-Ved-0024 EGY15057 Verticillium dahliae 60 0.0 978
WERAM-Tum-0012 CAZ81450 Tuber melanosporum 61 0.0 978
WERAM-Trr-0022 EGR50940 Trichoderma reesei 59 0.0 974
WERAM-Scs-0025 EDO04534 Sclerotinia sclerotiorum 61 0.0 972
WERAM-Ast-0030 CADATEAP00008674 Aspergillus terreus 66 0.0 971
WERAM-Asn-0034 CADANIAP00008970 Aspergillus nidulans 60 0.0 970
WERAM-Gag-0023 GGTG_08193T0 Gaeumannomyces graminis 64 0.0 969
WERAM-Map-0027 MAPG_07994T0 Magnaporthe poae 63 0.0 969
WERAM-Asf-0030 CADAFLAP00010870 Aspergillus flavus 66 0.0 967
WERAM-Asni-0035 CADANGAP00013288 Aspergillus niger 66 0.0 967
WERAM-Trv-0020 EHK16775 Trichoderma virens 58 0.0 965
WERAM-Coi-0026 EAS30564 Coccidioides immitis 58 0.0 949
WERAM-Miv-0005 MVLG_00286T0 Microbotryum violaceum 56 0.0 941
WERAM-Usm-0006 UM01183P0 Ustilago maydis 62 0.0 934
WERAM-Spr-0003 CBQ70591 Sporisorium reilianum 62 0.0 925
WERAM-Scj-0039 EEB09542 Schizosaccharomyces japonicus 59 0.0 924
WERAM-Pytr-0005 EDU40575 Pyrenophora triticirepentis 59 0.0 920
WERAM-Scp-0003 SPAC1250.01.1:pep Schizosaccharomyces pombe 60 0.0 917
WERAM-Phn-0020 SNOT_09308 Phaeosphaeria nodorum 57 0.0 915
WERAM-Pug-0020 EFP83552 Puccinia graminis 55 0.0 896
WERAM-Mel-0020 EGG12815 Melampsora laricipopulina 60 0.0 877
WERAM-Crn-0040 AAW46162 Cryptococcus neoformans 58 0.0 831
WERAM-Put-0005 PTTG_03431P0 Puccinia triticina 48 0.0 755
WERAM-Loa-0128 ENSLAFP00000011784.3 Loxodonta africana 58 0.0 716
WERAM-Fia-0131 ENSFALP00000010890.1 Ficedula albicollis 59 0.0 715
WERAM-Drm-0001 FBpp0075281 Drosophila melanogaster 59 0.0 715
WERAM-Tag-0080 ENSTGUP00000005661.1 Taeniopygia guttata 59 0.0 714
WERAM-Aim-0137 ENSAMEP00000013109.1 Ailuropoda melanoleuca 58 0.0 714
WERAM-Eqc-0203 ENSECAP00000021944.1 Equus caballus 58 0.0 714
WERAM-Mum-0064 ENSMUSP00000025862.7 Mus musculus 58 0.0 713
WERAM-Nol-0088 ENSNLEP00000010477.1 Nomascus leucogenys 58 0.0 713
WERAM-Ran-0079 ENSRNOP00000016740.3 Rattus norvegicus 58 0.0 713
WERAM-Tut-0024 ENSTTRP00000001909.1 Tursiops truncatus 58 0.0 712
WERAM-Caf-0024 ENSCAFP00000002979.4 Canis familiaris 58 0.0 712
WERAM-Bot-0078 ENSBTAP00000035551.3 Bos taurus 58 0.0 712
WERAM-Hos-0038 ENSP00000371638.1 Homo sapiens 58 0.0 712
WERAM-Orc-0059 ENSOCUP00000016214.2 Oryctolagus cuniculus 58 0.0 712
WERAM-Cap-0063 ENSCPOP00000004930.2 Cavia porcellus 58 0.0 712
WERAM-Dan-0051 ENSDNOP00000004971.3 Dasypus novemcinctus 58 0.0 712
WERAM-Poa-0182 ENSPPYP00000021564.2 Pongo abelii 58 0.0 712
WERAM-Otg-0178 ENSOGAP00000015276.2 Otolemur garnettii 58 0.0 712
WERAM-Ict-0071 ENSSTOP00000006128.2 Ictidomys tridecemlineatus 58 0.0 712
WERAM-Pes-0045 ENSPSIP00000006802.1 Pelodiscus sinensis 58 0.0 712
WERAM-Sus-0035 ENSSSCP00000005624.2 Sus scrofa 58 0.0 712
WERAM-Ova-0136 ENSOARP00000014227.1 Ovis aries 58 0.0 712
WERAM-Mup-0058 ENSMPUP00000005133.1 Mustela putorius furo 58 0.0 712
WERAM-Anc-0020 ENSACAP00000002825.3 Anolis carolinensis 58 0.0 711
WERAM-Gog-0005 ENSGGOP00000000508.2 Gorilla gorilla 58 0.0 711
WERAM-Sah-0078 ENSSHAP00000009101.1 Sarcophilus harrisii 58 0.0 711
WERAM-Mod-0027 ENSMODP00000004375.3 Monodelphis domestica 58 0.0 711
WERAM-Chs-0102 ENSCSAP00000004907.1 Chlorocebus sabaeus 58 0.0 711
WERAM-Gaga-0103 ENSGALP00000016509.3 Gallus gallus 56 0.0 709
WERAM-Fec-0018 ENSFCAP00000001456.3 Felis catus 58 0.0 707
WERAM-Leo-0110 ENSLOCP00000014138.1 Lepisosteus oculatus 58 0.0 706
WERAM-Pof-0026 ENSPFOP00000002687.2 Poecilia formosa 58 0.0 706
WERAM-Ptv-0007 ENSPVAP00000000854.1 Pteropus vampyrus 58 0.0 704
WERAM-Dar-0024 ENSDARP00000041411.7 Danio rerio 58 0.0 703
WERAM-Orn-0091 ENSONIP00000010318.1 Oreochromis niloticus 58 0.0 702
WERAM-Gaa-0147 ENSGACP00000019132.2 Gasterosteus aculeatus 59 0.0 702
WERAM-Xim-0070 ENSXMAP00000006373.1 Xiphophorus maculatus 58 0.0 701
WERAM-Myl-0048 ENSMLUP00000004094.2 Myotis lucifugus 58 0.0 699
WERAM-Orla-0040 ENSORLP00000004948.1 Oryzias latipes 57 0.0 699
WERAM-Xet-0101 ENSXETP00000033490.3