WERAM Information


Tag Content
WERAM ID WERAM-Put-0014
Ensembl Protein ID PTTG_07163P0
Gene Name
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
PTTG_07163 PTTG_07163T0 PTTG_07163P0
Status Unreviewed
Classification
Type Family E-value Score Start End
HDAC Class-II 1.20e-108 362.3 29 386
HDAC Class-I 5.80e-30 104.1 51 374
Organism Puccinia triticina
Domain Profile
  HDAC Class-II

   class-2.txt   3 glvydekmlkhqaleenkek.........hpEkpeRiqailsrlqeagllekleelkarkatkeelqlvHseehvelletaeklekeeles..ltvd 88 
g++++++mlkh + + ++ +pE+p+Ri++i++++++a+l+++le++k rkatkee++lvHse h +++e++ +++ ++l++ + +
PTTG_07163P0 29 GICHSQQMLKHWKPDAQWDTikdqddeneEPERPSRISRIMTQVSKAKLTTQLEHIKIRKATKEEIMLVHSEGHWKRIEETATMSIQDLKNrsAYFS 125
66777777777666555444455666667*****************************************************999999999444445 PP
class-2.txt 89 sdsiylesksikaarlavGavlelvdkvlkgelkngfavvRPPGHHaeestamGFClfnnvavaakllqqklk..vkkilivDwDvHh 174
s+y++ +++++arl++G v+e++++v++g++kngfavvRPPGHH+e++ ++GFC+fnn+a++ak l++ ++ vkk+l+vDwDvHh
PTTG_07163P0 126 RLSLYVNADTFDCARLSCGGVIEMCRAVMDGKIKNGFAVVRPPGHHSEPEDPSGFCVFNNAAISAKWLRTVYPerVKKVLLVDWDVHH 213
5689******************************************************************99888************* PP
class-2.txt 175 GnGtqeifykdpkvlylSlHRydkgs....ffpesgsgavdevgegkgegfnvNvawngglmgdaeylaafrevvlpiakeFkPdlvlvsaGfDaae 267
GnG+q+ fy+d++vly+S+HR+ + + f+p + ga ++vgeg+g+gfnvN++w++g+m da+y++af+++v+pia eF+Pd+v+vsaGfDaa+
PTTG_07163P0 235 GNGIQRSFYHDSSVLYISVHRFLQDNrteyFYPGNDWGASNRVGEGEGQGFNVNIPWPEGGMCDADYIYAFQRLVMPIAMEFDPDFVIVSAGFDAAK 331
9********************9554435559**9999************************************************************ PP
class-2.txt 268 gdplgglsvtakcyatltkqllklaggrvvlvlEGGynlkaiaeaveavvkaLlg 322
+dplg+++vt++++a++t++l++la+g+ vl+lEGGy+l+++a ++++++k+L+g
PTTG_07163P0 332 NDPLGECNVTPEGFAHMTHMLTSLANGNTVLALEGGYHLESLALSATECIKVLMG 386
****************************************************986 PP

  HDAC Class-I

   class-1.txt  13 eyhygqkhpmkpkrlsltheLvlnyglskkleivkpkkasaeellkfhseeyieflkkvepenaeelskelkkfnvgedcPvfdglfeycqlitGas 109
+ ++++p +p+r+s + v + +l+ +le +k +ka++ee++ +hse + + +++ + + ++l+++++ f+ v + f+ ++l++G+
PTTG_07163P0 51 DQDDENEEPERPSRISRIMTQVSKAKLTTQLEHIKIRKATKEEIMLVHSEGHWKRIEETATMSIQDLKNRSAYFS-RLSLYVNADTFDCARLSCGGV 146
55567889**************************************************99999999997776665.56788999************* PP
class-1.txt 110 leaakkLnkkead..iainwaGGlhhakkseasGfcyvnDivlailellk....khkrvlyididlhh 171
+e + + +++ + a+ G hh+ ++ sGfc n+ ++ l+ k+vl +d d+hh
PTTG_07163P0 147 IEMCRAVMDGKIKngFAVVRPPG-HHSEPEDPSGFCVFNNAAISAKWLRTvypeRVKKVLLVDWDVHH 213
*******9988762255555555.9********************99998322245799********* PP
class-1.txt 172 GDgveeafyttdrvmtvsfhky.....geeffPgt..GdlsdvgaekgkyyavnvPlkd.gidDesyekifksviskvieafePeavvlqcGaDsla 260
G+g++ fy+ + v+ +s+h++ e+f+Pg G + vg+++g+ + vn+P + g+ D y f++++ ++ f+P+ v++ G D+
PTTG_07163P0 235 GNGIQRSFYHDSSVLYISVHRFlqdnrTEYFYPGNdwGASNRVGEGEGQGFNVNIPWPEgGMCDADYIYAFQRLVMPIAMEFDPDFVIVSAGFDAAK 331
99*******************95444345799*97669999***************9662799********************************** PP
class-1.txt 261 gDrlgefnlsikghaecvkfvksf.nlpllvlGGGGYtlrnva 302
+D+lge n++ +g+a++ +++ s n ++++ GGY l+ +a
PTTG_07163P0 332 NDPLGECNVTPEGFAHMTHMLTSLaNGNTVLALEGGYHLESLA 374
***********************97777777788999998876 PP

Protein Sequence
(Fasta)
MAHENENGTF NSTSRHVPST SSSRPTRTGI CHSQQMLKHW KPDAQWDTIK DQDDENEEPE 60
RPSRISRIMT QVSKAKLTTQ LEHIKIRKAT KEEIMLVHSE GHWKRIEETA TMSIQDLKNR 120
SAYFSRLSLY VNADTFDCAR LSCGGVIEMC RAVMDGKIKN GFAVVRPPGH HSEPEDPSGF 180
CVFNNAAISA KWLRTVYPER VKKVLLVDWD VHHDRLASAH LIMYCYPCGP LSAPGNGIQR 240
SFYHDSSVLY ISVHRFLQDN RTEYFYPGND WGASNRVGEG EGQGFNVNIP WPEGGMCDAD 300
YIYAFQRLVM PIAMEFDPDF VIVSAGFDAA KNDPLGECNV TPEGFAHMTH MLTSLANGNT 360
VLALEGGYHL ESLALSATEC IKVLMGEAPP KLGCAMVASD VATETVDECL KIQSAFWKSL 420
PRQGLSAKYE LEMDGLSIPL GDVLKMHRSY DLYEAHGLCA IPAHDQQISG LSKSYQNQIM 480
VTDNVYDCKT LVLFMHDLNY IPKVIGILHH NRGSLRNEIF TESANVKDEN DALIAYNKVL 540
MDWIRKNDYG LVDVQVLPSY LSDLALDGVA KKAEQARTLK RMVNWIWNQF ISLSDCQNLV 600
LICLGEGCAA LPVFFEIKDI SSKLKASVHI PSFRQPPLKL PSDCNWHRVI SAGFLSSTEE 660
DRAQIRLWMD KYPYGKVNIC DQSRPSQILR SDWEKIAEFI GAKLAQPASS NLPSNRPQTN 720
GNNSPSNPVR GTLPHASDGS GTSNGRPIPK ATPNGIPAEN SAFPMDID 768
Nucleotide Sequence
(Fasta)
ATGGCGCACG AAAACGAAAA CGGAACATTC AACTCGACTT CTCGCCATGT CCCGTCTACT 60
TCCTCGTCCA GGCCCACCCG CACTGGGATA TGTCATTCCC AGCAGATGCT TAAACATTGG 120
AAGCCTGACG CCCAATGGGA TACGATTAAG GACCAGGATG ACGAAAATGA AGAACCCGAA 180
CGGCCTTCTA GAATATCTAG AATTATGACT CAAGTTTCAA AGGCGAAATT GACCACTCAG 240
TTGGAGCACA TCAAAATCCG GAAGGCTACC AAGGAGGAGA TCATGTTGGT TCACAGTGAG 300
GGACATTGGA AACGGATTGA GGAAACTGCA ACAATGTCAA TACAAGACCT AAAAAATCGC 360
TCTGCGTATT TTTCGCGACT GTCACTCTAC GTGAATGCAG ACACGTTTGA CTGTGCCCGA 420
CTATCATGTG GAGGAGTGAT CGAGATGTGT CGCGCGGTGA TGGACGGGAA GATTAAGAAT 480
GGCTTTGCCG TCGTCCGGCC CCCTGGTCAC CATTCTGAAC CTGAGGATCC CTCTGGTTTC 540
TGCGTCTTCA ATAACGCGGC CATCTCGGCT AAATGGCTCA GAACGGTCTA TCCGGAAAGG 600
GTGAAAAAGG TTCTGCTAGT GGACTGGGAT GTGCATCACG ATAGACTCGC CTCAGCTCAC 660
TTAATTATGT ATTGTTATCC CTGCGGCCCC TTATCTGCAC CAGGTAACGG AATCCAGCGG 720
TCTTTCTATC ACGATTCGAG TGTTTTGTAT ATCTCTGTTC ATCGCTTCCT TCAAGATAAT 780
CGGACAGAAT ACTTTTACCC AGGTAATGAT TGGGGGGCGA GTAATCGAGT GGGAGAGGGG 840
GAAGGCCAAG GCTTTAATGT CAACATTCCC TGGCCAGAGG GCGGAATGTG CGACGCCGAT 900
TACATCTACG CTTTCCAACG TCTCGTCATG CCCATAGCCA TGGAATTTGA CCCGGACTTT 960
GTCATCGTCT CCGCTGGATT TGATGCCGCC AAAAACGACC CATTGGGGGA ATGTAATGTC 1020
ACGCCCGAGG GGTTTGCTCA CATGACTCAT ATGTTAACGT CACTAGCAAA CGGAAATACC 1080
GTACTGGCAC TTGAGGGTGG TTATCACCTG GAATCTCTGG CATTGTCAGC TACTGAGTGT 1140
ATCAAAGTCT TGATGGGTGA AGCGCCACCA AAGCTGGGCT GTGCAATGGT TGCTAGCGAT 1200
GTGGCAACAG AGACCGTAGA TGAATGCTTG AAAATTCAAT CAGCCTTTTG GAAATCACTC 1260
CCCCGACAGG GGCTATCCGC TAAGTATGAA CTTGAGATGG ATGGTCTCAG TATTCCTCTC 1320
GGAGATGTCC TTAAAATGCA TCGGTCGTAC GATCTATATG AAGCCCATGG GCTGTGCGCC 1380
ATTCCAGCTC ACGACCAACA AATTTCTGGC CTCTCCAAAT CTTACCAGAA TCAAATCATG 1440
GTCACGGACA ATGTTTATGA TTGTAAAACA TTAGTCTTGT TCATGCACGA TCTTAATTAC 1500
ATCCCGAAAG TCATTGGAAT ATTGCATCAC AACAGGGGTA GTCTCCGCAA TGAAATCTTC 1560
ACGGAATCAG CGAATGTTAA AGACGAAAAC GACGCACTTA TCGCATACAA CAAGGTTTTG 1620
ATGGACTGGA TCCGAAAAAA TGACTATGGA CTGGTCGACG TCCAAGTCTT GCCTTCGTAT 1680
CTCTCGGATC TGGCACTCGA CGGTGTGGCG AAGAAAGCCG AGCAAGCGAG GACGCTCAAA 1740
CGGATGGTTA ATTGGATCTG GAATCAGTTC ATCTCCTTAT CCGACTGTCA AAACCTTGTG 1800
CTCATCTGTT TGGGAGAAGG CTGTGCCGCG CTTCCTGTGT TCTTTGAAAT AAAAGACATT 1860
TCTAGCAAGT TAAAGGCCTC GGTACACATT CCTAGTTTCA GACAGCCTCC TCTTAAGCTT 1920
CCTAGCGACT GTAATTGGCA TCGTGTGATA TCTGCTGGAT TCTTGTCTTC AACTGAGGAA 1980
GATCGAGCGC AAATCCGACT GTGGATGGAC AAATATCCTT ATGGGAAGGT GAACATATGC 2040
GACCAGTCCA GGCCGAGCCA GATCCTGCGA TCCGATTGGG AGAAGATCGC CGAGTTCATT 2100
GGCGCCAAAT TAGCCCAGCC TGCGAGCAGC AATCTTCCCT CGAACAGGCC GCAAACCAAT 2160
GGTAATAATT CTCCTAGTAA CCCCGTTCGT GGGACGCTTC CGCACGCCAG CGATGGCAGT 2220
GGTACTAGTA ATGGTCGCCC CATCCCCAAG GCCACTCCTA ATGGGATTCC TGCTGAGAAC 2280
TCCGCCTTCC CAATGGATAT TGATTAG 2308
Sequence Source Ensembl
Orthology
WERAM ID Ensembl Protein ID Species Identity E-value Score
WERAM-Pug-0031 EFP89333 Puccinia graminis 81 0.0 1254
WERAM-Mel-0037 EGG03660 Melampsora laricipopulina 65 0.0 861
WERAM-Miv-0034 MVLG_04888T0 Microbotryum violaceum 39 8e-140 495
WERAM-Crn-0010 AAW42071 Cryptococcus neoformans 36 6e-122 436
WERAM-Lab-0047 EDQ99497 Laccaria bicolor 38 1e-118 424
WERAM-Scj-0031 EEB08679 Schizosaccharomyces japonicus 38 4e-110 396
WERAM-Yal-0023 CAG79971 Yarrowia lipolytica 34 1e-107 388
WERAM-Scp-0036 SPBC800.03.1:pep Schizosaccharomyces pombe 33 1e-104 378
WERAM-Spr-0021 CBQ72644 Sporisorium reilianum 34 7e-104 375
WERAM-Kop-0012 CAY68916 Komagataella pastoris 33 3e-101 367
WERAM-Caa-0034 KGT64501 Candida albicans 34 3e-100 363
WERAM-Asc-0002 CADACLAP00000048 Aspergillus clavatus 36 8e-99 358
WERAM-Cag-0018 CAG60803 Candida glabrata 32 5e-98 356
WERAM-Usm-0012 UM02102P0 Ustilago maydis 33 7e-98 355
WERAM-Lem-0023 CBX90551 Leptosphaeria maculans 35 2e-96 351
WERAM-Pyt-0023 EFQ89752 Pyrenophora teres 36 2e-96 351
WERAM-Pytr-0015 EDU46537 Pyrenophora triticirepentis 37 4e-96 350
WERAM-Sac-0037 YNL021W Saccharomyces cerevisiae 30 2e-94 344
WERAM-Kll-0020 CAG99415 Kluyveromyces lactis 31 2e-94 344
WERAM-Mao-0002 MGG_01076T0 Magnaporthe oryzae 34 5e-93 339
WERAM-Nec-0012 EFNCRP00000001681 Neurospora crassa 34 2e-92 337
WERAM-Coi-0028 EAS30926 Coccidioides immitis 34 4e-92 337
WERAM-Ved-0005 EGY17208 Verticillium dahliae 31 2e-91 335
WERAM-Tum-0026 CAZ84932 Tuber melanosporum 44 4e-91 333
WERAM-Chg-0033 EAQ86725 Chaetomium globosum 38 9e-91 332
WERAM-Trv-0041 EHK18675 Trichoderma virens 32 3e-90 330
WERAM-Trr-0039 EGR46026 Trichoderma reesei 33 7e-90 329
WERAM-Asg-0010 AAS51704 Ashbya gossypii 31 1e-89 328
WERAM-Z