WERAM Information


Tag Content
WERAM ID WERAM-Cag-0003
Ensembl Protein ID CAG57932
Gene Name AO438_000257 AO439_000247 AO440_000223 AO441_000131 AO442_000255 AO443_000257
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CAGL0B01441g CAG57932 CAG57932
Status Unreviewed
Classification
Type Family E-value Score Start End
HDAC Class-I 1.60e-166 551.6 19 330
Organism Candida glabrata
Domain Profile
  HDAC Class-I

  class-1.txt   1 kkvayaydedvgeyhygqkhpmkpkrlsltheLvlnyglskkleivkpkkasaeellkfhseeyieflkkvepenaeelskelkkfnvgedcPvfdgl 98 
k+vay+yd dvg+y yg++hpmkp+r+++th+L++nygl+kk+ei+++k a+++e+++fh++eyi+fl++v+p+n e ++ke+ kfnvg+dcPvfdgl
CAG57932 19 KRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGL 116
589*********************************************************************************************** PP
class-1.txt 99 feycqlitGasleaakkLnkkeadiainwaGGlhhakkseasGfcyvnDivlailellkkhkrvlyididlhhGDgveeafyttdrvmtvsfhkygee 196
+eyc++++G+s+e+a++Ln++++d+ain+aGGlhhakkseasGfcy+nDivl+i+ell++h+rvlyidid+hhGDgveeafyttdrvmt+sfhkyge
CAG57932 117 YEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGE- 213
*************************************************************************************************. PP
class-1.txt 197 ffPgtGdlsdvgaekgkyyavnvPlkdgidDesyekifksviskvieafePeavvlqcGaDslagDrlgefnlsikghaecvkfvksfnlpllvlGGG 294
ffPgtG+l+d+g++kgkyyavnvPl+dgidD +y+++f++vi k++e+++P+avvlqcG+Dsl+gDrlg+fnls++gha+cv++vksf +p++v+GGG
CAG57932 214 FFPGTGELRDIGVGKGKYYAVNVPLRDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGG 311
************************************************************************************************** PP
class-1.txt 295 GYtlrnvaRcwtyetavvl 313
GYt+rnvaR+w++et++++
CAG57932 312 GYTMRNVARTWCFETGLLN 330
***************9975 PP

Protein Sequence
(Fasta)
MVYESKPFDP ITVKPNDKKR VAYFYDADVG NYAYGAGHPM KPHRIRMTHS LIMNYGLYKK 60
MEIYRAKPAT KQEMCQFHTD EYIDFLSRVT PDNLEMFKKE SVKFNVGDDC PVFDGLYEYC 120
SISGGGSMEG AARLNRGKCD VAINYAGGLH HAKKSEASGF CYLNDIVLGI IELLRYHPRV 180
LYIDIDVHHG DGVEEAFYTT DRVMTCSFHK YGEFFPGTGE LRDIGVGKGK YYAVNVPLRD 240
GIDDATYRSV FEPVIGKIME WYQPSAVVLQ CGGDSLSGDR LGCFNLSMEG HANCVNYVKS 300
FGIPMMVVGG GGYTMRNVAR TWCFETGLLN NVVLDQELPY NEYYEYYGPD YKLDVRPSNM 360
YNVNTPEYLD KILLGIFQNL ENTKYAPSVQ LNNVPNDPED KGDEEEDTNE AKDTKGGSQY 420
ARDNMVQNDT EFY 433
Nucleotide Sequence
(Fasta)
ATGGTGTATG AGTCGAAGCC GTTTGATCCG ATCACGGTGA AGCCCAATGA CAAGAAGCGT 60
GTGGCCTACT TCTATGATGC GGATGTTGGA AACTATGCCT ATGGTGCGGG ACACCCTATG 120
AAGCCGCATA GGATAAGGAT GACGCACTCG CTGATTATGA ACTATGGGCT GTACAAGAAG 180
ATGGAGATAT ACCGGGCCAA GCCGGCCACG AAGCAGGAGA TGTGTCAGTT CCACACGGAC 240
GAGTACATCG ACTTCTTGTC CCGTGTTACA CCGGACAACT TGGAGATGTT CAAGAAAGAG 300
AGTGTCAAGT TCAATGTCGG TGACGATTGT CCCGTGTTTG ACGGTCTGTA TGAGTATTGT 360
AGCATATCGG GTGGTGGGTC TATGGAAGGC GCTGCCCGGT TGAACAGAGG CAAGTGTGAC 420
GTTGCCATCA ACTATGCGGG TGGTCTGCAC CACGCCAAGA AGTCGGAGGC GTCTGGTTTC 480
TGTTATTTAA ATGACATCGT GCTTGGAATA ATCGAGTTGC TGAGGTACCA CCCTAGAGTG 540
CTCTACATCG ACATCGATGT GCACCACGGT GACGGTGTGG AAGAGGCCTT TTACACAACA 600
GACAGAGTCA TGACTTGTTC GTTCCACAAA TACGGTGAGT TCTTCCCCGG TACTGGTGAA 660
CTGAGGGACA TCGGTGTAGG AAAGGGTAAA TACTACGCGG TGAATGTGCC ACTGAGGGAC 720
GGTATCGATG ACGCTACCTA CAGATCAGTG TTTGAACCCG TGATTGGCAA GATCATGGAG 780
TGGTATCAGC CATCTGCCGT GGTGTTGCAA TGTGGTGGTG ATTCGCTTTC CGGAGATCGT 840
CTGGGTTGTT TCAATTTATC TATGGAGGGA CACGCCAACT GTGTGAACTA CGTGAAATCA 900
TTTGGTATCC CCATGATGGT CGTTGGTGGC GGTGGTTACA CAATGAGAAA CGTTGCTAGG 960
ACGTGGTGTT TCGAAACAGG GCTACTGAAT AACGTGGTGC TAGACCAAGA ACTACCGTAC 1020
AATGAGTACT ACGAGTACTA CGGCCCCGAT TACAAGCTGG ACGTCAGACC ATCCAACATG 1080
TACAACGTAA ATACACCAGA GTACCTGGAC AAGATACTGC TGGGCATATT CCAGAACCTG 1140
GAGAACACCA AGTACGCGCC TAGTGTGCAA CTGAACAATG TGCCCAACGA CCCAGAGGAC 1200
AAAGGTGACG AAGAAGAGGA CACGAACGAG GCGAAGGACA CCAAAGGTGG CTCCCAATAC 1260
GCCAGAGACA ACATGGTGCA GAACGACACA GAGTTTTACT AG 1303
Sequence Source Ensembl
Orthology
WERAM ID Ensembl Protein ID Species Identity E-value Score
WERAM-Kll-0018 CAG99124 Kluyveromyces lactis 92 0.0 826
WERAM-Sac-0039 YNL330C Saccharomyces cerevisiae 93 0.0 822
WERAM-Asg-0034 AAS54885 Ashbya gossypii 91 0.0 815
WERAM-Kop-0004 CAY67954 Komagataella pastoris 88 0.0 791
WERAM-Caa-0018 KGT69072 Candida albicans 86 0.0 773
WERAM-Yal-0022 CAG79885 Yarrowia lipolytica 82 0.0 743
WERAM-Asni-0020 CADANGAP00005938 Aspergillus niger 77 0.0 659
WERAM-Asf-0020 CADAFLAP00008921 Aspergillus flavus 76 0.0 657
WERAM-Asn-0024 CADANIAP00005952 Aspergillus nidulans 75 0.0 652
WERAM-Asc-0037 CADACLAP00008612 Aspergillus clavatus 77 0.0 647
WERAM-Coi-0024 EAS33504 Coccidioides immitis 75 0.0 645
WERAM-Asfu-0015 CADAFUAP00003503 Aspergillus fumigatus 77 0.0 645
WERAM-Scs-0023 EDO03342 Sclerotinia sclerotiorum 77 0.0 642
WERAM-Ved-0020 EGY15146 Verticillium dahliae 73 0.0 636
WERAM-Gag-0026 GGTG_08607T0 Gaeumannomyces graminis 73 8e-176 613
WERAM-Map-0015 MAPG_05105T0 Magnaporthe poae 73 2e-175 612
WERAM-Mao-0017 MGG_05857T0 Magnaporthe oryzae 72 1e-174 610
WERAM-Tum-0029 CAZ85499 Tuber melanosporum 74 2e-174 608
WERAM-Trv-0003 EHK19072 Trichoderma virens 70 2e-174 608
WERAM-Ast-0010 CADATEAP00004306 Aspergillus terreus 72 1e-173 607
WERAM-Pyt-0025 EFQ89270 Pyrenophora teres 76 1e-173 606
WERAM-Pytr-0033 EDU43668 Pyrenophora triticirepentis 75 4e-173 605
WERAM-Trr-0017 EGR48353 Trichoderma reesei 69 5e-173 604
WERAM-Chg-0005 EAQ93036 Chaetomium globosum 69 6e-173 604
WERAM-Phn-0005 SNOT_00508 Phaeosphaeria nodorum 76 1e-172 603
WERAM-Lem-0026 CBX91288 Leptosphaeria maculans 75 3e-171 598
WERAM-Usm-0011 UM02065P0 Ustilago maydis 77 4e-171 598
WERAM-Spr-0020 CBQ72606 Sporisorium reilianum 75 8e-171 597
WERAM-Pug-0005 EFP76878 Puccinia graminis 69 2e-170 596
WERAM-Miv-0039 MVLG_05722T0 Microbotryum violaceum 68 1e-169 593
WERAM-Zyt-0024 Mycgr3P51809 Zymoseptoria tritici 71 9e-169 590
WERAM-Nec-0007 EFNCRP00000000997 Neurospora crassa 73 2e-168 588
WERAM-Crn-0023 AAW44291 Cryptococcus neoformans 73 6e-167 584
WERAM-Lab-0002 EDR16061 Laccaria bicolor 70 1e-164 576
WERAM-Mel-0028 EGG09787 Melampsora laricipopulina 74 7e-163 570
WERAM-Aso-0022 CADAORAP00005645 Aspergillus oryzae 68 1e-160 563
WERAM-Gaga-0034 ENSGALP00000005212.3 Gallus gallus 66 1e-157 553
WERAM-Tut-0167 ENSTTRP00000014262.1 Tursiops truncatus 64 1e-157 553
WERAM-Tag-0022 ENSTGUP00000001473.1 Taeniopygia guttata 66 2e-157 553
WERAM-Ptv-0152 ENSPVAP00000012567.1 Pteropus vampyrus 66 3e-157 552
WERAM-Mum-0093 ENSMUSP00000099657.4 Mus musculus 66 4e-157 551
WERAM-Ran-0062 ENSRNOP00000012854.5 Rattus norvegicus 66 4e-157 551
WERAM-Ova-0221 ENSOARP00000022517.1 Ovis aries 66 4e-157 551
WERAM-Bot-0118 ENSBTAP00000016877.5 Bos taurus 66 4e-157 551
WERAM-Mup-0173 ENSMPUP00000015122.1 Mustela putorius furo 66 4e-157 551
WERAM-Anc-0033 ENSACAP00000004062.3 Anolis carolinensis 65 5e-157 551
WERAM-Otg-0072 ENSOGAP00000005101.2 Otolemur garnettii 66 6e-157 551
WERAM-Ocp-0006 ENSOPRP00000000780.1 Ochotona princeps 66 7e-157 551
WERAM-Nol-0026 ENSNLEP00000003167.1 Nomascus leucogenys 66 7e-157 550
WERAM-Hos-0092 ENSP00000362649.3 Homo sapiens 66 7e-157 550
WERAM-Gog-0132 ENSGGOP00000011454.2 Gorilla gorilla 66 7e-157 550
WERAM-Orc-0030 ENSOCUP00000003186.2 Oryctolagus cuniculus 66 8e-157 550
WERAM-Cap-0092 ENSCPOP00000006985.2 Cavia porcellus 66 8e-157 550
WERAM-Leo-0176 ENSLOCP00000020984.1 Lepisosteus oculatus 64 1e-156 550
WERAM-Loa-0056 ENSLAFP00000004079.2 Loxodonta africana 66 2e-156 549
WERAM-Xim-0229 ENSXMAP00000019038.1 Xiphophorus maculatus 66 4e-156 548
WERAM-Pof-0034 ENSPFOP00000002952.2 Poecilia formosa 66 4e-156 548
WERAM-Orla-0197 ENSORLP00000022529.1 Oryzias latipes 66 4e-156 548
WERAM-Drm-0018 FBpp0073173 Drosophila melanogaster 65 5e-156 548
WERAM-Dar-0035 ENSDARP00000051798.4 Danio rerio 64 5e-156 548
WERAM-Caf-0116 ENSCAFP00000015619.3 Canis familiaris 66 7e-156 547
WERAM-Ect-0064 ENSETEP00000006883.1 Echinops telfairi 64 8e-156 547
WERAM-Poa-0013 ENSPPYP00000001838.2 Pongo abelii 66 1e-155 546
WERAM-Myl-0152 ENSMLUP00000012593.2 Myotis lucifugus 66 2e-155 545
WERAM-Mod-0165 ENSMODP00000022264.3 Monodelphis domestica 64 3e-155 545
WERAM-Ict-0111 ENSSTOP00000011457.2 Ictidomys tridecemlineatus 64 3e-155 545
WERAM-Fia-0139 ENSFALP00000011453.1 Ficedula albicollis 64 3e-155 545
WERAM-Dan-0175 ENSDNOP00000033349.1 Dasypus novemcinctus 65 3e-155 545
WERAM-Paa-0030 ENSPANP00000015145.1 Papio anubis 64 3e-155 545
WERAM-Chs-0191 ENSCSAP00000011772.1 Chlorocebus sabaeus 64 3e-155 545
WERAM-Sus-0028 ENSSSCP00000004781.2 Sus scrofa 64 6e-155 544
WERAM-Tar-0085 ENSTRUP00000016627.1 Takifugu rubripes 65 6e-155 544
WERAM-Aim-0087 ENSAMEP00000008076.1 Ailuropoda melanoleuca 66 1e-154 543
WERAM-Scp-0033 SPBC36.05c.1:pep Schizosaccharomyces pombe 67 1e-154 543
WERAM-Pat-0155 ENSPTRP00000049696.3 Pan troglodytes 64 2e-154 543
WERAM-Xet-0050 ENSXETP00000015978.3 Xenopus tropicalis 64 3e-154 542
WERAM-Orn-0087 ENSONIP00000009730.1 Oreochromis niloticus 66 4e-154 541
WERAM-Asm-0120 ENSAMXP00000012237.1 Astyanax mexicanus 63 7e-154 540
WERAM-Meg-0047 ENSMGAP00000004521.2 Meleagris gallopavo 66 8e-154 540
WERAM-Cii-0014 ENSCINP00000005410.3 Ciona intestinalis 63 1e-153 540
WERAM-Gaa-0093 ENSGACP00000012045.1 Gasterosteus aculeatus 64 2e-153 539
WERAM-Ten-0109 ENSTNIP00000012136.1 Tetraodon nigroviridis 62 2e-153 539
WERAM-Eqc-0125 ENSECAP00000014039.1 Equus caballus 67 2e-153 539
WERAM-Put-0006 PTTG_04745P0 Puccinia triticina 66 2e-153 539
WERAM-Anp-0136 ENSAPLP00000014652.1 Anas platyrhynchos 65 9e-153 537
WERAM-Gam-0033 ENSGMOP00000003469.1 Gadus morhua 64 1e-152 536
WERAM-Scj-0003 EEB05565 Schizosaccharomyces japonicus 62 2e-152 536
WERAM-Ere-0068 ENSEEUP00000005465.1 Erinaceus europaeus 64 2e-151 532
WERAM-Sah-0134 ENSSHAP00000014467.1 Sarcophilus harrisii 64 3e-151 532
WERAM-Pes-0020 ENSPSIP00000004435.1 Pelodiscus sinensis 64 3e-151 532
WERAM-Fec-0156 ENSFCAP00000015379.2 Felis catus 63 4e-151 531
WERAM-Php-0050 PP1S223_52V6.1 Physcomitrella patens 62 4e-149 525
WERAM-Cae-0005 C53A5.3 Caenorhabditis elegans 59 1e-148 523
WERAM-Sem-0128 EFJ38890 Selaginella moellendorffii 64 2e-147 519
WERAM-Tra-0318 Traes_7DL_578CF3F0D.2 Triticum aestivum 60 1e-146 516
WERAM-Cym-0014 CMJ129CT Cyanidioschyzon merolae 61 3e-146 515
WERAM-Tas-0085 ENSTSYP00000008588.1 Tarsius syrichta 62 6e-146 514
WERAM-Brd-0020 BRADI1G37290.1 Brachypodium distachyon 58 9e-146 514
WERAM-Thc-0029 EOY20838 Theobroma cacao 61 9e-146 514
WERAM-Lac-0087 ENSLACP00000011092.1 Latimeria chalumnae 58 2e-145 513
WERAM-Caj-0052 ENSCJAP00000008409.2 Callithrix jacchus 64 3e-145 512
WERAM-Ora-0034 ENSOANP00000005760.2 Ornithorhynchus anatinus 64 8e-145 511
WERAM-Glm-0046 GLYMA05G02540.1 Glycine max 60 1e-144 509
WERAM-Mae-0008 ENSMEUP00000000621.1 Macropus eugenii 60 2e-144 509
WERAM-Vip-0012 ENSVPAP00000001394.1 Vicugna pacos 69 1e-143 506
WERAM-Orbr-0098 OB08G20020.1 Oryza brachyantha 57 2e-143 506
WERAM-Met-0084 KEH36404 Medicago truncatula 59 5e-143 504
WERAM-Viv-0086 VIT_14s0006g01820.t01 Vitis vinifera 60 6e-143 504
WERAM-Osl-0002 ABO94711 Ostreococcus lucimarinus 61 1e-142 503
WERAM-Mam-0073 ENSMMUP00000011716.2 Macaca mulatta 59 2e-142 503
WERAM-Pot-0149 POPTR_0015s09400.1 Populus trichocarpa 59 3e-142 502
WERAM-Sot-0088 PGSC0003DMT400076252 Solanum tuberosum 61 4e-142 501
WERAM-Sei-0035 Si010167m Setaria italica 57 5e-142 501
WERAM-Sol-0120 Solyc09g091440.2.1 Solanum lycopersicum 57 5e-142 501
WERAM-Sob-0086 Sb06g015420.1 Sorghum bicolor 57 5e-142 501
WERAM-Orr-0094 ORUFI08G12880.1 Oryza rufipogon 56 5e-142 501
WERAM-Ors-0081 OS08T0344100-01 Oryza sativa 56 8e-142 501
WERAM-Orp-0087 OPUNC08G10650.1 Oryza punctata 56 8e-142 501
WERAM-Orm-0085 OMERI08G09730.1 Oryza meridionalis 56 8e-142 501
WERAM-Ori-0098 BGIOSGA028498-PA Oryza indica 56 8e-142 501
WERAM-Orgl-0088 OGLUM08G12440.1 Oryza glumaepatula 56 8e-142 501
WERAM-Org-0090 ORGLA08G0103000.1 Oryza glaberrima 56 8e-142 501
WERAM-Prc-0059 ENSPCAP00000005589.1 Procavia capensis 64 8e-142 500
WERAM-Orb-0066 OBART06G19560.1 Oryza barthii 61 1e-141 500
WERAM-Orni-0039 ONIVA04G09660.1 Oryza nivara 57 2e-141 499
WERAM-Prp-0056 EMJ02177 Prunus persica 61 5e-141 498
Created Date 25-Jun-2016